DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33057 and trpt1

DIOPT Version :9

Sequence 1:NP_001286980.1 Gene:CG33057 / 318833 FlyBaseID:FBgn0053057 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_002940273.1 Gene:trpt1 / 100216285 XenbaseID:XB-GENE-994188 Length:228 Species:Xenopus tropicalis


Alignment Length:205 Identity:83/205 - (40%)
Similarity:119/205 - (58%) Gaps:24/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QQINTQLSKKLSWLLRHGAKTEGITIRADGFVSVPDLQKHPRYLCFTLEKLKEIAAADAKQRYTL 69
            |..:..|||.||:.|||||...|:.:..||||.|..|...|::..|:...::.:.:.:.|||:||
 Frog    18 QDPDVHLSKCLSYALRHGAVNLGLPMGTDGFVPVSSLLLLPQFRTFSQVDIERVVSCNDKQRFTL 82

  Fly    70 RWNPELGVHEIRANQGHSLAVLEGEAGGLENITHVSQVPL-------AVHGTYYRHWGAIRSQGL 127
            |::...|..||||||||||.|            .|...||       |:||||:|||.:|:.:||
 Frog    83 RYSYADGALEIRANQGHSLQV------------EVELTPLGEELPNQAIHGTYFRHWPSIQQRGL 135

  Fly   128 SRMNRNHVHFACSD---ETNSTLSGFRSDCQILIYLNVEKVLADGIPIYRSSNNVLLCPG-IEGF 188
            |||||.|:|. |::   |....:||.|.||::.|::::.|.:|||:..:.|||.|||.|| .:|.
 Frog   136 SRMNRTHIHL-CTELPGEGQECISGMRRDCEVAIFIDLPKAVADGLLFFWSSNRVLLTPGNADGL 199

  Fly   189 IHSSYFQRVV 198
            :...||.|.:
 Frog   200 LLPKYFLRAL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33057NP_001286980.1 PTS_2-RNA 11..183 CDD:280125 76/181 (42%)
trpt1XP_002940273.1 PTS_2-RNA 24..194 CDD:376644 76/182 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4728
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12878
Inparanoid 1 1.050 145 1.000 Inparanoid score I4332
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005232
OrthoInspector 1 1.000 - - oto102490
Panther 1 1.100 - - LDO PTHR12684
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1542
SonicParanoid 1 1.000 - - X4245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.180

Return to query results.
Submit another query.