DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lz and rnt-1

DIOPT Version :9

Sequence 1:NP_511099.2 Gene:lz / 31883 FlyBaseID:FBgn0002576 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001370335.1 Gene:rnt-1 / 172243 WormBaseID:WBGene00004393 Length:301 Species:Caenorhabditis elegans


Alignment Length:124 Identity:68/124 - (54%)
Similarity:83/124 - (66%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 QQEHPGE-LVRTSNPYFLCSALPAHWRSNKTLPMAFKVVALAEVGDGTYVTIRAGNDENCCAELR 343
            ||..|.: |.::|:|..|.:|||.||||||:....|.||.|..|.|.|.|:|.|||||..|.|:|
 Worm    14 QQPAPAKTLEKSSSPNILYTALPKHWRSNKSFQEPFYVVLLTPVPDNTEVSIWAGNDEKPCEEVR 78

  Fly   344 NFTTQMKNDVAKFNDLRFVGRSGRGKSFTLTITVATSPPQVATYAKAIKVTVDGPREPR 402
            |...::...||||||||||||||||:.|.|||.:.::|..|||....|||||||||:.|
 Worm    79 NEKAKVHRQVAKFNDLRFVGRSGRGRKFHLTIVIHSAPMMVATVKNVIKVTVDGPRDAR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lzNP_511099.2 Runt 283..404 CDD:279225 66/121 (55%)
rnt-1NP_001370335.1 Runt 22..137 CDD:395684 64/114 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - otm14562
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.870

Return to query results.
Submit another query.