DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL27 and rpmA

DIOPT Version :10

Sequence 1:NP_787971.1 Gene:mRpL27 / 318825 FlyBaseID:FBgn0053002 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_417652.1 Gene:rpmA / 945190 ECOCYCID:EG50002 Length:85 Species:Escherichia coli


Alignment Length:67 Identity:32/67 - (47%)
Similarity:39/67 - (58%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGFGRNGTLFAMEHG 86
            |.||.||||||.: .:..|..|.:...|..|..|:|:..|..|:||.|.|||.||:.||||...|
E. coli     2 AHKKAGGSTRNGR-DSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADG 65

  Fly    87 KV 88
            ||
E. coli    66 KV 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL27NP_787971.1 Ribosomal_L27 22..88 CDD:480976 30/65 (46%)
rpmANP_417652.1 rpmA 1..83 CDD:235464 32/67 (48%)

Return to query results.
Submit another query.