DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL27 and Mrpl27

DIOPT Version :9

Sequence 1:NP_001260028.1 Gene:mRpL27 / 318825 FlyBaseID:FBgn0053002 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_444391.1 Gene:Mrpl27 / 94064 MGIID:2137224 Length:148 Species:Mus musculus


Alignment Length:129 Identity:54/129 - (41%)
Similarity:74/129 - (57%) Gaps:1/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKADQPLMTTVRNASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVG 73
            |....|....||:||||||||::|..|.:|.||.|.:..:||:|..|.||.||...|:|||.:||
Mouse    18 LSPTAPTALAVRHASKKTGGSSKNLGGKSRGKHYGIKKMEGHYVHAGNILGTQRQFRWHPGAHVG 82

  Fly    74 FGRNGTLFAMEHGKVYVTCEAIDPNWDHT-WIQRNYAGRQGQNIYKKFFNVVPENQHQRFRLVE 136
            .|||..|:|:|.|.|..|.:...||..:| .:....:..:|..:||.|.:|||......|:||:
Mouse    83 LGRNKCLYALEEGIVRYTKDVYVPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEGTFKLVD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL27NP_001260028.1 Ribosomal_L27 22..88 CDD:294256 35/65 (54%)
Mrpl27NP_444391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..48 12/19 (63%)
Ribosomal_L27 31..101 CDD:279368 36/69 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8976
eggNOG 1 0.900 - - E1_COG0211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9543
Inparanoid 1 1.050 95 1.000 Inparanoid score I5047
Isobase 1 0.950 - 0 Normalized mean entropy S3203
OMA 1 1.010 - - QHG46090
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003189
OrthoInspector 1 1.000 - - oto92584
orthoMCL 1 0.900 - - OOG6_101181
Panther 1 1.100 - - LDO PTHR15893
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1150
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.