DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL27 and MRP7

DIOPT Version :9

Sequence 1:NP_001260028.1 Gene:mRpL27 / 318825 FlyBaseID:FBgn0053002 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_014393.1 Gene:MRP7 / 855727 SGDID:S000004950 Length:371 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:32/92 - (34%)
Similarity:49/92 - (53%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VRNASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGFGRNGTLFAM 83
            ||||:|:..||..:.|..| .:..|.:..:|..||.|.|:..|..|:|:||.|||.|::.::||:
Yeast    25 VRNATKRAAGSRTSMKDSA-GRRLGPKKYEGQDVSTGEIIMRQRGTKFYPGENVGIGKDHSIFAL 88

  Fly    84 EHGKVYVTCEAIDPNWDHTWIQRNYAG 110
            |.|.|....:...|       :|.:.|
Yeast    89 EPGVVRYYLDPFHP-------KRKFIG 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL27NP_001260028.1 Ribosomal_L27 22..88 CDD:294256 25/65 (38%)
MRP7NP_014393.1 L27 27..110 CDD:272882 30/90 (33%)
Ribosomal_L27_C 135..371 CDD:408264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I3011
eggNOG 1 0.900 - - E1_COG0211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3203
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003189
OrthoInspector 1 1.000 - - oto99223
orthoMCL 1 0.900 - - OOG6_101181
Panther 1 1.100 - - LDO PTHR15893
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1150
SonicParanoid 1 1.000 - - X5700
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.