DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL27 and AT2G16930

DIOPT Version :9

Sequence 1:NP_001260028.1 Gene:mRpL27 / 318825 FlyBaseID:FBgn0053002 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001077904.1 Gene:AT2G16930 / 816196 AraportID:AT2G16930 Length:154 Species:Arabidopsis thaliana


Alignment Length:83 Identity:34/83 - (40%)
Similarity:47/83 - (56%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RNASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGFGRNGTLFAME 84
            |.|:|||.|||:|.: .:.||..|.:...|..|..|.|:..|..||||||..||.|::.||||::
plant    45 RWATKKTAGSTKNGR-DSNPKFLGVKKFGGESVIPGNIIVRQRGTRFHPGDYVGIGKDHTLFALK 108

  Fly    85 HGKV-YVTCEAIDPNWDH 101
            .|:| :...:.....|.|
plant   109 EGRVRFEKSKITGRKWIH 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL27NP_001260028.1 Ribosomal_L27 22..88 CDD:294256 30/65 (46%)
AT2G16930NP_001077904.1 rpmA 47..127 CDD:235464 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3941
eggNOG 1 0.900 - - E1_COG0211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1177118at2759
OrthoFinder 1 1.000 - - FOG0003189
OrthoInspector 1 1.000 - - otm2556
orthoMCL 1 0.900 - - OOG6_101181
Panther 1 1.100 - - LDO PTHR15893
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5700
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.