DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL27 and mrpl27

DIOPT Version :9

Sequence 1:NP_001260028.1 Gene:mRpL27 / 318825 FlyBaseID:FBgn0053002 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001018516.1 Gene:mrpl27 / 553709 ZFINID:ZDB-GENE-050522-129 Length:148 Species:Danio rerio


Alignment Length:139 Identity:54/139 - (38%)
Similarity:76/139 - (54%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKADQPLMTTVRNASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQL--TTRFHPGLN 71
            |.::.|.:...|.||||:|||::|..|.:..:..|::.|||:.|..|.|||||.  ..|:|||.:
Zfish    16 LFSETPTVVLARFASKKSGGSSKNLGGKSSGRRYGYKKQDGNFVHAGNILATQRKGLMRWHPGAH 80

  Fly    72 VGFGRNGTLFAMEHGKVYVTCEAIDPNWDHTWIQRNYAGRQ-------GQNIYKKFFNVVPENQH 129
            ||.|.|.||:|:|.|.|..|.|...|      :.|:...|:       |..:||.|.||||..|.
Zfish    81 VGIGTNKTLYALEDGIVRYTKEVYVP------LPRSAEARENIPQLPKGAVLYKTFVNVVPTKQE 139

  Fly   130 QRFRLVEEI 138
            .:|.||:.:
Zfish   140 NKFTLVDMV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL27NP_001260028.1 Ribosomal_L27 22..88 CDD:294256 33/67 (49%)
mrpl27NP_001018516.1 Ribosomal_L27 29..101 CDD:279368 34/71 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I10000
eggNOG 1 0.900 - - E1_COG0211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9543
Inparanoid 1 1.050 86 1.000 Inparanoid score I5135
OMA 1 1.010 - - QHG46090
OrthoDB 1 1.010 - - D1177118at2759
OrthoFinder 1 1.000 - - FOG0003189
OrthoInspector 1 1.000 - - oto41508
orthoMCL 1 0.900 - - OOG6_101181
Panther 1 1.100 - - LDO PTHR15893
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1150
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.