DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL27 and MRPL27

DIOPT Version :9

Sequence 1:NP_001260028.1 Gene:mRpL27 / 318825 FlyBaseID:FBgn0053002 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_057588.1 Gene:MRPL27 / 51264 HGNCID:14483 Length:148 Species:Homo sapiens


Alignment Length:124 Identity:48/124 - (38%)
Similarity:68/124 - (54%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VRNASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGFGRNGTLFAM 83
            ||.||||:|||::|..|.:..:.:|.:..:||:|..|.|:|||...|:|||.:||.|:|..|:|:
Human    28 VRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYAL 92

  Fly    84 EHGKVYVTCEAIDPNWDHTWIQRNYAG-------RQGQNIYKKFFNVVPENQHQRFRLV 135
            |.|.|..|.|...|:      .||...       .:|..:||.|.:|||......|:||
Human    93 EEGIVRYTKEVYVPH------PRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL27NP_001260028.1 Ribosomal_L27 22..88 CDD:294256 30/65 (46%)
MRPL27NP_057588.1 Ribosomal_L27 31..101 CDD:395803 31/69 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9904
eggNOG 1 0.900 - - E1_COG0211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9543
Inparanoid 1 1.050 81 1.000 Inparanoid score I5228
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46090
OrthoDB 1 1.010 - - D1177118at2759
OrthoFinder 1 1.000 - - FOG0003189
OrthoInspector 1 1.000 - - oto89016
orthoMCL 1 0.900 - - OOG6_101181
Panther 1 1.100 - - LDO PTHR15893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.