DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL27 and Mrpl27

DIOPT Version :9

Sequence 1:NP_001260028.1 Gene:mRpL27 / 318825 FlyBaseID:FBgn0053002 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001099301.1 Gene:Mrpl27 / 287635 RGDID:1309090 Length:148 Species:Rattus norvegicus


Alignment Length:135 Identity:54/135 - (40%)
Similarity:72/135 - (53%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKADQPLMTTVRNASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVG 73
            |....|....||:||||||||::|..|.:|.||.|.:..:||:|..|.||.||...|:|||.:||
  Rat    18 LSPTAPTALAVRSASKKTGGSSKNLGGKSRGKHYGIKKMEGHYVHAGNILGTQRQFRWHPGAHVG 82

  Fly    74 FGRNGTLFAMEHGKVYVTCEAIDPNWDHTWIQRNYAG-------RQGQNIYKKFFNVVPENQHQR 131
            .|:|..|:|:|.|.|..|.|...||      .:|...       .:|..:||.|.:|||......
  Rat    83 LGKNKCLYALEEGIVRYTKEVYVPN------PKNSEAVNLVTSLPKGAVLYKTFVHVVPAKPEGT 141

  Fly   132 FRLVE 136
            |:||:
  Rat   142 FKLVD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL27NP_001260028.1 Ribosomal_L27 22..88 CDD:294256 34/65 (52%)
Mrpl27NP_001099301.1 Ribosomal_L27 31..101 CDD:279368 35/69 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9001
eggNOG 1 0.900 - - E1_COG0211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9543
Inparanoid 1 1.050 92 1.000 Inparanoid score I4990
OMA 1 1.010 - - QHG46090
OrthoDB 1 1.010 - - D1177118at2759
OrthoFinder 1 1.000 - - FOG0003189
OrthoInspector 1 1.000 - - oto96149
orthoMCL 1 0.900 - - OOG6_101181
Panther 1 1.100 - - LDO PTHR15893
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.