DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL27 and Y54G11A.17

DIOPT Version :9

Sequence 1:NP_001260028.1 Gene:mRpL27 / 318825 FlyBaseID:FBgn0053002 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001254426.1 Gene:Y54G11A.17 / 13187936 WormBaseID:WBGene00185067 Length:124 Species:Caenorhabditis elegans


Alignment Length:120 Identity:38/120 - (31%)
Similarity:58/120 - (48%) Gaps:12/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GSTRNKKGHARP----KHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGFGRN-GTLFAMEH-- 85
            ||.:..:|..||    ..||...:||..|.:..:|..|....:||||||.:..: |......|  
 Worm     8 GSFQQIRGLLRPPKNLPFRGIFRKDGEVVRKDDLLVNQFKMNYHPGLNVYYENDRGERLLRAHCD 72

  Fly    86 GKVYVTCEAIDPNWDHTWIQ--RNYAGRQGQNIYKKFFNVVPENQHQRFRLVEEI 138
            |.|.::.|..||:::   |:  :.|..|:..::||..|||:|....|:..|..||
 Worm    73 GIVRISQEKCDPDYE---IEEMKGYEYRKDVDLYKMTFNVIPLELSQKHTLRHEI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL27NP_001260028.1 Ribosomal_L27 22..88 CDD:294256 21/66 (32%)
Y54G11A.17NP_001254426.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I4130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003189
OrthoInspector 1 1.000 - - oto18332
orthoMCL 1 0.900 - - OOG6_101181
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1150
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.