Sequence 1: | NP_001260032.1 | Gene: | dpy / 318824 | FlyBaseID: | FBgn0053196 | Length: | 22949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011537045.1 | Gene: | VPS37B / 79720 | HGNCID: | 25754 | Length: | 344 | Species: | Homo sapiens |
Alignment Length: | 139 | Identity: | 43/139 - (30%) |
---|---|---|---|
Similarity: | 56/139 - (40%) | Gaps: | 39/139 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 19090 IPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVK 19154
Fly 19155 QRPVF---------VPSPVHPTPAPQPGVVNIPS----VAQPVHPTYQPPVVERPAIYDVYYPP- 19205
Fly 19206 -PPSRPGVI 19213 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |