DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpy and Hmcn2

DIOPT Version :9

Sequence 1:NP_001260032.1 Gene:dpy / 318824 FlyBaseID:FBgn0053196 Length:22949 Species:Drosophila melanogaster
Sequence 2:XP_006498564.1 Gene:Hmcn2 / 665700 MGIID:2677838 Length:5092 Species:Mus musculus


Alignment Length:487 Identity:145/487 - (29%)
Similarity:198/487 - (40%) Gaps:104/487 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTL------GSFTCTCFPGY-RGNGFHCE 167
            :||:...:...|.....|..|:..:..|..:||..|...      .|..|.....| ...|...:
Mouse  4543 INGMIPESLADGDLRVQDFQEHYVQTGPGQLFAGSTQRFLHDSLPASLRCNHSIQYDETRGLQPQ 4607

  Fly   168 DIDECQDPAIAARCVENAECCNLPAHFLCK-------CKDGYEGDGE-VLCTDVDECR-NPENCG 223
            .:...:..:|::.....||..|.......:       |.:|:|.|.: ..|.|.|||. .|..| 
Mouse  4608 LVQHLRASSISSAFDPEAEALNFQLTTALQTEENEVGCPEGFEPDVQGAFCVDKDECSGGPSPC- 4671

  Fly   224 PNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECS-YPNVCGPGAICTNLEGSYRC--DCPPG 285
             :..|.|.||:::||||.|:.....:| .|:|||||: ..::|.....|.||.|||.|  .|.||
Mouse  4672 -SHTCRNAPGHFSCSCPTGFSLAWDHR-NCRDVDECAGNTHLCQEEQRCVNLLGSYNCLASCRPG 4734

  Fly   286 Y--DGDGRSESGCVDQDECAR--TPCGRNADCLNTDGSFRCLCPDGY--SGDPMNGCEDVDEC-A 343
            :  ..||   |.|.|.|||..  ..|..|..|.||.|...|.||.||  .|..: .|.|::|| .
Mouse  4735 FRVTADG---SNCEDVDECLEQLDECHYNQLCENTPGGHHCGCPRGYRQQGHSL-PCLDINECLQ 4795

  Fly   344 TNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQL-------GYGPGATDIAPY 401
            ...||..  :|.||.||::|.||.|..|..|... .:|...|.|.:       .:||......|.
Mouse  4796 LPTPCVY--QCQNLQGSYRCLCPPGQTLLRDGRT-CIPLERNRQNITIVSHRSPFGPWLRSRVPR 4857

  Fly   402 QRTS---------GAGL------------------ACLDIDECNQPDGVAKCGTNAKCINFPGSY 439
            ..:|         |:|.                  .|.|:|||.    |.....:| |.|..|||
Mouse  4858 PSSSYHTWVSLRPGSGALNSVGRAWCPPGFIRQDGVCADLDECR----VRSLCQHA-CQNTEGSY 4917

  Fly   440 RCLCPSGFQ----GQGYLHCENINECQDN--PCGENAICTDTVGSFVCT---CKPDY-----TGD 490
            .||||||::    |:   :|::||||:::  .||...:|.:|.|||.|.   |...|     .|.
Mouse  4918 YCLCPSGYRLLPSGK---NCQDINECEEDGIECGPGQMCFNTRGSFQCVDTPCPTTYRQGSSPGT 4979

  Fly   491 PFRGCVDIDECTA----------LDKPCGQHA 512
            .||.|  ..:|:|          |..|.|..|
Mouse  4980 CFRRC--SQDCSASGPSTLQYRLLPLPLGVRA 5009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpyNP_001260032.1 EGF_3 137..166 CDD:289699 8/35 (23%)
EGF_CA 212..247 CDD:238011 15/35 (43%)
EGF_CA 255..>286 CDD:214542 15/33 (45%)
EGF_CA 298..331 CDD:238011 15/36 (42%)
EGF_CA 338..373 CDD:238011 15/35 (43%)
EGF_CA 413..456 CDD:238011 18/46 (39%)
EGF_CA 457..490 CDD:238011 14/42 (33%)
EGF_CA 497..>529 CDD:214542 6/26 (23%)
EGF_CA 580..>612 CDD:214542
EGF_3 676..702 CDD:289699
EGF_CA 1022..1056 CDD:214542
EGF_CA 2227..2260 CDD:238011
EGF_CA 2393..>2422 CDD:214542
DUF4758 4088..4282 CDD:292572
DUF4696 4127..4678 CDD:292395
DUF4758 4275..4448 CDD:292572
DUF4758 4377..4574 CDD:292572
DUF4758 4581..4754 CDD:292572
DUF4758 4683..4847 CDD:292572
DUF4758 4785..4964 CDD:292572
DUF4696 4841..5385 CDD:292395
DUF4758 4887..5098 CDD:292572
DUF4758 5193..5371 CDD:292572
DUF4758 5294..5487 CDD:292572
DUF4758 5445..5650 CDD:292572
DUF4758 5700..5877 CDD:292572
DUF4696 5756..6396 CDD:292395
DUF4758 5802..5979 CDD:292572
DUF4758 5964..6171 CDD:292572
DUF4758 6181..6360 CDD:292572
DUF4696 6339..6999 CDD:292395
DUF4758 6662..6839 CDD:292572
DUF4758 6764..6941 CDD:292572
DUF4758 6866..7045 CDD:292572
DUF4758 6968..7179 CDD:292572
DUF4696 7024..7569 CDD:292395
DUF4758 7172..7383 CDD:292572
DUF4696 7330..7964 CDD:292395
DUF4758 7400..7587 CDD:292572
DUF4758 7538..7707 CDD:292572
DUF4758 7798..7979 CDD:292572
DUF4758 7946..8126 CDD:292572
YppG 18767..>18832 CDD:290883
Med25_SD1 18795..18955 CDD:288132
MISS 19026..19258 CDD:292450
ZP 22576..22811 CDD:214579
Zona_pellucida <22714..22810 CDD:278526
Hmcn2XP_006498564.1 vWFA 38..196 CDD:238119
Ig 445..511 CDD:319273
IG 525..605 CDD:214652
I-set 609..693 CDD:369462
IG 707..783 CDD:214652
IG_like 793..876 CDD:214653
I-set 889..969 CDD:369462
Ig 992..1058 CDD:386229
IG 1076..1157 CDD:214652
Ig 1161..1242 CDD:386229
Ig 1262..1336 CDD:386229
I-set 1345..1429 CDD:369462
I-set 1449..1523 CDD:369462
IG 1553..1633 CDD:214652
IGc2 1654..1716 CDD:197706
Ig 1741..1819 CDD:386229
Ig 1839..1903 CDD:386229
I-set 1907..1986 CDD:369462
Ig_3 1998..2073 CDD:372822
Ig 2092..2179 CDD:386229
Ig 2183..2273 CDD:386229
Ig 2291..2367 CDD:386229
IGc2 2389..2451 CDD:197706
I-set 2476..2554 CDD:369462
I-set 2558..2650 CDD:369462
I-set 2668..2740 CDD:369462
Ig 2782..2859 CDD:386229
I-set 2876..2954 CDD:369462
I-set 2966..3046 CDD:369462
I-set 3050..3141 CDD:369462
Ig 3145..3233 CDD:386229
Ig 3256..3320 CDD:319273
Ig 3347..3422 CDD:386229
IG_like 3436..3511 CDD:214653
IGc2 3530..3592 CDD:197706
Ig 3614..3695 CDD:386229
I-set 3699..3786 CDD:369462
Ig 3789..3874 CDD:386229
Ig 3900..3967 CDD:319273
I-set 3974..4060 CDD:369462
Ig 4064..4151 CDD:386229
I-set 4155..4240 CDD:369462
IGc2 4259..4321 CDD:197706
I-set 4335..4421 CDD:369462
G2F 4423..4605 CDD:369383 13/61 (21%)
FXa_inhibition 4664..4699 CDD:373209 13/37 (35%)
EGF_CA 4701..4744 CDD:311536 19/45 (42%)
EGF_CA 4746..4783 CDD:214542 15/36 (42%)
EGF_CA 4789..4829 CDD:214542 16/42 (38%)
EGF_CA 4896..4935 CDD:214542 18/46 (39%)
EGF_CA 4936..4974 CDD:214542 14/37 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.