Sequence 1: | NP_001260032.1 | Gene: | dpy / 318824 | FlyBaseID: | FBgn0053196 | Length: | 22949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030100352.2 | Gene: | Col6a5 / 665033 | MGIID: | 3648134 | Length: | 2691 | Species: | Mus musculus |
Alignment Length: | 179 | Identity: | 46/179 - (25%) |
---|---|---|---|
Similarity: | 59/179 - (32%) | Gaps: | 60/179 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 8719 PGYNGNPKVGCSPPQD-PCDPNPCGLNALCELDNGNPICYCPKGLTGNP----FKNCI------- 8771
Fly 8772 ---PEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVL 8833
Fly 8834 ----------SNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGA 8872 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |