DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpy and Col6a5

DIOPT Version :9

Sequence 1:NP_001260032.1 Gene:dpy / 318824 FlyBaseID:FBgn0053196 Length:22949 Species:Drosophila melanogaster
Sequence 2:XP_038938539.1 Gene:Col6a5 / 501047 RGDID:1565804 Length:2637 Species:Rattus norvegicus


Alignment Length:170 Identity:46/170 - (27%)
Similarity:60/170 - (35%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  8712 RGVCKCPPGYNGNP--KVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEG 8774
            :|| |.|.|:.|:|  |.....|..|..|.|.|...| .|..|      .||.:|.|       |
  Rat  1692 KGV-KGPTGFPGDPGQKGDAGDPGIPGGPGPKGFKGL-TLSQG------LKGGSGLP-------G 1741

  Fly  8775 DECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCEL-----PSNPC--DPSPCGPNTQCSV 8832
            .:..|...||....                |||...||||     .::||  :..|..|......
  Rat  1742 SQGPPGRRGPKGTA----------------GQPIYSPCELIQFLRNNSPCWKEKCPVYPTELVFA 1790

  Fly  8833 LSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGA 8872
            |...|.  |....:.|:.:||...::.:| ...|.|..||
  Rat  1791 LDQSFG--TSERRFNETRDTIASIIDDLN-IRENNCPVGA 1827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpyNP_001260032.1 EGF_3 137..166 CDD:289699
EGF_CA 212..247 CDD:238011
EGF_CA 255..>286 CDD:214542
EGF_CA 298..331 CDD:238011
EGF_CA 338..373 CDD:238011
EGF_CA 413..456 CDD:238011
EGF_CA 457..490 CDD:238011
EGF_CA 497..>529 CDD:214542
EGF_CA 580..>612 CDD:214542
EGF_3 676..702 CDD:289699
EGF_CA 1022..1056 CDD:214542
EGF_CA 2227..2260 CDD:238011
EGF_CA 2393..>2422 CDD:214542
DUF4758 4088..4282 CDD:292572
DUF4696 4127..4678 CDD:292395
DUF4758 4275..4448 CDD:292572
DUF4758 4377..4574 CDD:292572
DUF4758 4581..4754 CDD:292572
DUF4758 4683..4847 CDD:292572
DUF4758 4785..4964 CDD:292572
DUF4696 4841..5385 CDD:292395
DUF4758 4887..5098 CDD:292572
DUF4758 5193..5371 CDD:292572
DUF4758 5294..5487 CDD:292572
DUF4758 5445..5650 CDD:292572
DUF4758 5700..5877 CDD:292572
DUF4696 5756..6396 CDD:292395
DUF4758 5802..5979 CDD:292572
DUF4758 5964..6171 CDD:292572
DUF4758 6181..6360 CDD:292572
DUF4696 6339..6999 CDD:292395
DUF4758 6662..6839 CDD:292572
DUF4758 6764..6941 CDD:292572
DUF4758 6866..7045 CDD:292572
DUF4758 6968..7179 CDD:292572
DUF4696 7024..7569 CDD:292395
DUF4758 7172..7383 CDD:292572
DUF4696 7330..7964 CDD:292395
DUF4758 7400..7587 CDD:292572
DUF4758 7538..7707 CDD:292572
DUF4758 7798..7979 CDD:292572
DUF4758 7946..8126 CDD:292572
YppG 18767..>18832 CDD:290883
Med25_SD1 18795..18955 CDD:288132
MISS 19026..19258 CDD:292450
ZP 22576..22811 CDD:214579
Zona_pellucida <22714..22810 CDD:278526
Col6a5XP_038938539.1 vWFA 31..193 CDD:412136
vWFA 263..417 CDD:412136
vWA_collagen 469..618 CDD:238749
vWA_collagen 655..816 CDD:238749
VWA 842..1012 CDD:395045
VWA 1033..1200 CDD:395045
Collagen 1426..1483 CDD:396114
Collagen 1495..1546 CDD:396114
Collagen 1553..1610 CDD:396114
Collagen 1586..1652 CDD:396114
Collagen 1634..1753 CDD:396114 24/75 (32%)
VWA 1787..>1928 CDD:395045 11/44 (25%)
vWFA_subfamily_ECM 1991..2165 CDD:238727
vWFA_subfamily_ECM 2318..2496 CDD:238727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.