Sequence 1: | NP_001260032.1 | Gene: | dpy / 318824 | FlyBaseID: | FBgn0053196 | Length: | 22949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005720.1 | Gene: | lgmn / 448252 | XenbaseID: | XB-GENE-950605 | Length: | 433 | Species: | Xenopus tropicalis |
Alignment Length: | 132 | Identity: | 27/132 - (20%) |
---|---|---|---|
Similarity: | 46/132 - (34%) | Gaps: | 11/132 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 3952 DITVGTTTQRIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSS 4016
Fly 4017 NPETETPTTLPSRP--TTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASIT-SESTTREV 4078
Fly 4079 YT 4080 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 50 | 1.000 | Domainoid score | I11480 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |