DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpy and CDHR4

DIOPT Version :9

Sequence 1:NP_001260032.1 Gene:dpy / 318824 FlyBaseID:FBgn0053196 Length:22949 Species:Drosophila melanogaster
Sequence 2:XP_016861855.1 Gene:CDHR4 / 389118 HGNCID:34527 Length:841 Species:Homo sapiens


Alignment Length:819 Identity:169/819 - (20%)
Similarity:257/819 - (31%) Gaps:253/819 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  6363 SESPETPTTLP------SDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLE-TTVPSVTLETT 6420
            |||....|.|.      |.:|..|    |.|.....|.|..|  :.||.|..: |.|..:||.::
Human    80 SESQGPGTVLQFLSFNCSSYTPTP----TLELLNVQPPTTFF--NPPSLARWQGTYVGKLTLSSS 138

  Fly  6421 T----------SVPMGSTGG-------------------QVTGQTTAPPSEVRTTIRVEESTLPS 6456
            .          .|.:..|.|                   |..||..:|..|:   |:|.|:..|.
Human   139 AQLDALMVNHYKVQLKFTCGNHVMEGSLSVDVQRDLSHIQCAGQFASPAGEM---IQVPETVTPG 200

  Fly  6457 RSTDRTSPSESPETPTTLPSDFITRPHSEKTTESTRDVP-TTRPFEAS------TPSSASSGN-- 6512
            ...            .||....:....::.:..|.:|:| ...||..:      .||....|.  
Human   201 ARL------------YTLLLPGLELHGAQMSIISAQDLPHFPGPFSINEQGWLQAPSQGLLGQAQ 253

  Fly  6513 -----NCSISYFRNHYKCSNR-----FNRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDV 6567
                 ..|:| |.....|...     ....:.:.:..|..:..|:|.:..  |.||......|.|
Human   254 KVFQLQISVS-FGQRQSCQGMVIVKVLPVPSSQVSFLEQAQNITIPENLA--PGSEVVQVQARGV 315

  Fly  6568 PTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVT----------GQTTAPPSEVRTTI 6622
            .......:..|||.........|. .|||.:.:..|.|...          ||..| .:::..|:
Human   316 DLRYEILSPVPSPLFSIGRADGVV-RTTTPLELARTSGTAVSRLQVKAFEQGQLWA-SAKLNLTM 378

  Fly  6623 RVEESTL-PSRSTDRTTPSESPETP---TILPSDFTTRPHSDQTTESTRDVPTTRPFE-----AS 6678
            .|:...| |.|.......|:.|||.   |:|         :..|.|....|..|..::     :|
Human   379 NVQLVNLWPPRCLPALLVSQIPETAPVGTVL---------NTLTCEDPDSVGATLDYKLWFRSSS 434

  Fly  6679 TPRPV-----------TLETAVPSVTLETTTNVPIGSTGGQ------------VTGQTTATPSEV 6720
            .|..:           ||:...|....:...::.: ..|||            ||.....:|:..
Human   435 NPASLCLYDRVLEVNATLDCDTPGACFQHAASILV-LDGGQPQMTTEVPVLVMVTPINEFSPACA 498

  Fly  6721 RTTIRVEESTLPSR------STDRTTPSESPE-----TPTTL-------------PSDFTTR--- 6758
            ..|.||:|...|..      .||...|.::.|     .|||.             |.|:..:   
Human   499 PRTFRVQEDAAPHTLLGSVVGTDMDYPHDNIEYYTSGGPTTFAVDRLSGEVHLLGPLDYEQQRLY 563

  Fly  6759 -------PH-SDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQT 6815
                   .| .||..........|...|....:..:.|...|  ..|.|...|:|.: .:||:.:
Human   564 RLTVLVIDHGQDQNPNHHLSGSCTITIEVEDVNDHAPECEPP--FQELTIYAPLGRS-VEVTKMS 625

  Fly  6816 TSSPSEVRTTIGLEESTLPSRSTDRTSPSES-------------PETPTTL----------PSDF 6857
            ...|.|.:..| ...|.:...|.:|.....:             ||.|.|.          ||  
Human   626 CQIPQEPQRLI-YSYSIVGGNSQNRFILQGAILVHSDLVLGPFWPEQPRTYELLICVADAGPS-- 687

  Fly  6858 ITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSE---TTTN----------VPIGST 6909
              .||  .:|.:|..|... |..|||.:.::..|||||..:.   |.|.          |.:.:|
Human   688 --TPH--LSTTATIIVHLV-PRRASTVATSTHRTTVPSTMTPMLVTDTEAFWQPQPWFVVVLTAT 747

  Fly  6910 G-----------GQVTE------QTTSSPSE------VRTTIGLEESTLPSRSTDRTSPSESPET 6951
            |           |::.:      |..|.|::      ::.|.|..|..|           |:|:.
Human   748 GALLLLALGWLLGRLLQGLAQLLQAPSKPAQALLLNSIQGTEGSIEGFL-----------EAPKM 801

  Fly  6952 P-TTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSA 6989
            . :..||..::..|.|...:.:|   |.|.:..:|.:.|
Human   802 EMSQAPSSVMSLQHFDGRAQDSR---TGRDYLFNTHTGA 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpyNP_001260032.1 EGF_3 137..166 CDD:289699
EGF_CA 212..247 CDD:238011
EGF_CA 255..>286 CDD:214542
EGF_CA 298..331 CDD:238011
EGF_CA 338..373 CDD:238011
EGF_CA 413..456 CDD:238011
EGF_CA 457..490 CDD:238011
EGF_CA 497..>529 CDD:214542
EGF_CA 580..>612 CDD:214542
EGF_3 676..702 CDD:289699
EGF_CA 1022..1056 CDD:214542
EGF_CA 2227..2260 CDD:238011
EGF_CA 2393..>2422 CDD:214542
DUF4758 4088..4282 CDD:292572
DUF4696 4127..4678 CDD:292395
DUF4758 4275..4448 CDD:292572
DUF4758 4377..4574 CDD:292572
DUF4758 4581..4754 CDD:292572
DUF4758 4683..4847 CDD:292572
DUF4758 4785..4964 CDD:292572
DUF4696 4841..5385 CDD:292395
DUF4758 4887..5098 CDD:292572
DUF4758 5193..5371 CDD:292572
DUF4758 5294..5487 CDD:292572
DUF4758 5445..5650 CDD:292572
DUF4758 5700..5877 CDD:292572
DUF4696 5756..6396 CDD:292395 11/38 (29%)
DUF4758 5802..5979 CDD:292572
DUF4758 5964..6171 CDD:292572
DUF4758 6181..6360 CDD:292572
DUF4696 6339..6999 CDD:292395 169/819 (21%)
DUF4758 6662..6839 CDD:292572 47/239 (20%)
DUF4758 6764..6941 CDD:292572 49/235 (21%)
DUF4758 6866..7045 CDD:292572 36/161 (22%)
DUF4758 6968..7179 CDD:292572 5/22 (23%)
DUF4696 7024..7569 CDD:292395
DUF4758 7172..7383 CDD:292572
DUF4696 7330..7964 CDD:292395
DUF4758 7400..7587 CDD:292572
DUF4758 7538..7707 CDD:292572
DUF4758 7798..7979 CDD:292572
DUF4758 7946..8126 CDD:292572
YppG 18767..>18832 CDD:290883
Med25_SD1 18795..18955 CDD:288132
MISS 19026..19258 CDD:292450
ZP 22576..22811 CDD:214579
Zona_pellucida <22714..22810 CDD:278526
CDHR4XP_016861855.1 Cadherin_repeat 294..384 CDD:206637 21/93 (23%)
Cadherin_repeat 398..492 CDD:206637 19/103 (18%)
Cadherin_repeat 499..598 CDD:206637 19/98 (19%)
Cadherin_repeat <638..702 CDD:206637 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.