DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpy and nompC

DIOPT Version :9

Sequence 1:	NP_001260032.1	Gene:	dpy / 318824	FlyBaseID:	FBgn0053196	Length:	22949	Species:	Drosophila melanogaster
Sequence 2:	NP_523483.2	Gene:	nompC / 33768	FlyBaseID:	FBgn0016920	Length:	1761	Species:	Drosophila melanogaster

Alignment Length:	135	Identity:	31/135 - (22%)
Similarity:	39/135 - (28%)	Gaps:	25/135 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly  7413 SVPMGSTGG--------QVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSDF 7469
            |.|.|..||        :.....|.||.|..|.   .|...|:...|..|..:|.........|.
  Fly     2 SQPRGGRGGGRGGGVGRKTPSSLTGPPDESATP---SERATPASKADSDPKDDSSSNGDKKDMDL 63

  Fly  7470 TTRPHSDQTTESSRDVPTT----------QPFESSTPRPVTLEIAVPPVTSETTTNVPIGSTGGQ 7524
            ...|.......|.||....          .|.|:...:   ||..|..| .|...::|:......
  Fly    64 FPAPKPPSAGASIRDTANKVLGLAMKSEWTPIEAELKK---LEKYVANV-GEDGNHIPLAGVHDM 124

  Fly  7525 VTGQT 7529
            .||.|
  Fly   125 NTGMT 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpy	NP_001260032.1	EGF_3	137..166	CDD:289699
		EGF_CA	212..247	CDD:238011
		EGF_CA	255..>286	CDD:214542
		EGF_CA	298..331	CDD:238011
		EGF_CA	338..373	CDD:238011
		EGF_CA	413..456	CDD:238011
		EGF_CA	457..490	CDD:238011
		EGF_CA	497..>529	CDD:214542
		EGF_CA	580..>612	CDD:214542
		EGF_3	676..702	CDD:289699
		EGF_CA	1022..1056	CDD:214542
		EGF_CA	2227..2260	CDD:238011
		EGF_CA	2393..>2422	CDD:214542
		DUF4758	4088..4282	CDD:292572
		DUF4696	4127..4678	CDD:292395
		DUF4758	4275..4448	CDD:292572
		DUF4758	4377..4574	CDD:292572
		DUF4758	4581..4754	CDD:292572
		DUF4758	4683..4847	CDD:292572
		DUF4758	4785..4964	CDD:292572
		DUF4696	4841..5385	CDD:292395
		DUF4758	4887..5098	CDD:292572
		DUF4758	5193..5371	CDD:292572
		DUF4758	5294..5487	CDD:292572
		DUF4758	5445..5650	CDD:292572
		DUF4758	5700..5877	CDD:292572
		DUF4696	5756..6396	CDD:292395
		DUF4758	5802..5979	CDD:292572
		DUF4758	5964..6171	CDD:292572
		DUF4758	6181..6360	CDD:292572
		DUF4696	6339..6999	CDD:292395
		DUF4758	6662..6839	CDD:292572
		DUF4758	6764..6941	CDD:292572
		DUF4758	6866..7045	CDD:292572
		DUF4758	6968..7179	CDD:292572
		DUF4696	7024..7569	CDD:292395	31/135 (23%)
		DUF4758	7172..7383	CDD:292572
		DUF4696	7330..7964	CDD:292395	31/135 (23%)
		DUF4758	7400..7587	CDD:292572	31/135 (23%)
		DUF4758	7538..7707	CDD:292572
		DUF4758	7798..7979	CDD:292572
		DUF4758	7946..8126	CDD:292572
		YppG	18767..>18832	CDD:290883
		Med25_SD1	18795..18955	CDD:288132
		MISS	19026..19258	CDD:292450
		ZP	22576..22811	CDD:214579
		Zona_pellucida	<22714..22810	CDD:278526
nompC	NP_523483.2	ANK repeat	129..157	CDD:293786	1/1 (100%)
		Ank_2	131..228	CDD:289560
		ANK	155..319	CDD:238125
		ANK repeat	159..186	CDD:293786
		ANK repeat	232..265	CDD:293786
		Ank_2	237..331	CDD:289560
		ANK	263..387	CDD:238125
		ANK repeat	267..298	CDD:293786
		ANK repeat	300..331	CDD:293786
		Ank_2	305..398	CDD:289560
		ANK	329..454	CDD:238125
		ANK repeat	367..398	CDD:293786
		ANK repeat	400..431	CDD:293786
		Ank_2	405..498	CDD:289560
		ANK	428..555	CDD:238125
		ANK repeat	433..463	CDD:293786
		ANK repeat	469..499	CDD:293786
		ANK	496..641	CDD:238125
		ANK repeat	501..532	CDD:293786
		Ank_2	507..616	CDD:289560
		ANK repeat	534..575	CDD:293786
		ANK repeat	577..616	CDD:293786
		Ank_2	625..722	CDD:289560
		ANK	654..780	CDD:238125
		ANK repeat	660..690	CDD:293786
		ANK repeat	692..723	CDD:293786
		Ank_2	697..790	CDD:289560
		ANK	720..847	CDD:238125
		ANK repeat	725..757	CDD:293786
		ANK repeat	759..790	CDD:293786
		Ank_5	779..834	CDD:290568
		ANK	787..915	CDD:238125
		ANK repeat	792..824	CDD:293786
		ANK repeat	861..893	CDD:293786
		Ank_4	865..915	CDD:290365
		Ank_4	929..995	CDD:290365
		ANK repeat	932..972	CDD:293786
		ANK	969..1096	CDD:238125
		ANK repeat	974..1007	CDD:293786
		Ank_2	979..1074	CDD:289560
		ANK repeat	1009..1041	CDD:293786
		ANK	1039..1159	CDD:238125
		ANK repeat	1043..1074	CDD:293786
		Ank_2	1048..1135	CDD:289560
		ANK repeat	1076..1101	CDD:293786
		ANK repeat	1109..1134	CDD:293786
		Ion_trans	<1393..1598	CDD:278921
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910