DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpy and Matn2

DIOPT Version :9

Sequence 1:NP_001260032.1 Gene:dpy / 318824 FlyBaseID:FBgn0053196 Length:22949 Species:Drosophila melanogaster
Sequence 2:NP_001345709.1 Gene:Matn2 / 17181 MGIID:109613 Length:956 Species:Mus musculus


Alignment Length:513 Identity:137/513 - (26%)
Similarity:203/513 - (39%) Gaps:112/513 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CT-NDCDKDGTKCTHGACLNG----VCHCNDGYGGCNCVDKDENECK-QRPCDVFAH-----CTN 146
            || :.|......|.| .|||.    :|.|..||    .:..|:..|: |..|....|     |.|
Mouse   237 CTVHMCSVLEHNCAH-FCLNTPGSYICKCKQGY----ILSTDQKTCRIQDLCATEDHGCEQLCVN 296

  Fly   147 TLGSFTCTCFPGY--RGNGFHCEDIDECQDPAIAARCVEN----AECCNLPAHFLCKCKDGYE-G 204
            .||||.|.|:.||  ..:|..|..:|.|..        ||    .||.|..:.:||:|.:|:. .
Mouse   297 MLGSFVCQCYSGYTLAEDGKRCTAVDYCAS--------ENHGCEHECVNAESSYLCRCHEGFALN 353

  Fly   205 DGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGA 269
            ..:..|:.:|.|.: .|.|....|.|...:..|.|..|:: .||.|:.|:.::.|:. |..|...
Mouse   354 SDKKTCSKIDYCAS-SNHGCQHECVNAQTSALCRCLKGFM-LNPDRKTCRRINYCAL-NKPGCEH 415

  Fly   270 ICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGY-SGDPM 333
            .|.|.|..:.|.|..||:.|...:: |...|.||:...|....||||:.||.|.|.:|: ..|.:
Mouse   416 ECVNTEEGHYCRCRQGYNLDPNGKT-CSRVDHCAQQDHGCEQLCLNTEESFVCQCSEGFLINDDL 479

  Fly   334 NGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDI 398
            ..|...|.|..:|. |....|||...||.|:||.|.||..|                        
Mouse   480 KTCSRADYCLLSNH-GCEYSCVNTDKSFACQCPEGHVLRSD------------------------ 519

  Fly   399 APYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYL------HCEN 457
                     |..|..:|.|...|.    |....|::...|:.|.|     .:||:      .|..
Mouse   520 ---------GKTCAKLDSCALGDH----GCEHSCVSSEDSFVCQC-----FEGYILRDDGKTCRR 566

  Fly   458 INECQDNPCGENAICTDTVGSFVCTCKPDY-TGDPFRGCVDIDECTALDKPCGQHAVCENTVPGY 521
            .:.|||...|...:|.::..|:||.|...: ..:..:.|...:.|.:....| :| :|.|....|
Mouse   567 KDVCQDVNHGCEHLCVNSGESYVCKCLEGFRLAEDGKRCRRKNVCKSTQHGC-EH-MCVNNGNSY 629

  Fly   522 NCKCPQGY----DGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIG 575
            .|:|.:|:    |||...:  |.:..::::                  |.:||.:.:|
Mouse   630 LCRCSEGFVLAEDGKHCKR--CTEGPIDLV------------------FVIDGSKSLG 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpyNP_001260032.1 EGF_3 137..166 CDD:289699 13/35 (37%)
EGF_CA 212..247 CDD:238011 9/34 (26%)
EGF_CA 255..>286 CDD:214542 8/30 (27%)
EGF_CA 298..331 CDD:238011 13/33 (39%)
EGF_CA 338..373 CDD:238011 15/34 (44%)
EGF_CA 413..456 CDD:238011 10/48 (21%)
EGF_CA 457..490 CDD:238011 9/33 (27%)
EGF_CA 497..>529 CDD:214542 8/31 (26%)
EGF_CA 580..>612 CDD:214542
EGF_3 676..702 CDD:289699
EGF_CA 1022..1056 CDD:214542
EGF_CA 2227..2260 CDD:238011
EGF_CA 2393..>2422 CDD:214542
DUF4758 4088..4282 CDD:292572
DUF4696 4127..4678 CDD:292395
DUF4758 4275..4448 CDD:292572
DUF4758 4377..4574 CDD:292572
DUF4758 4581..4754 CDD:292572
DUF4758 4683..4847 CDD:292572
DUF4758 4785..4964 CDD:292572
DUF4696 4841..5385 CDD:292395
DUF4758 4887..5098 CDD:292572
DUF4758 5193..5371 CDD:292572
DUF4758 5294..5487 CDD:292572
DUF4758 5445..5650 CDD:292572
DUF4758 5700..5877 CDD:292572
DUF4696 5756..6396 CDD:292395
DUF4758 5802..5979 CDD:292572
DUF4758 5964..6171 CDD:292572
DUF4758 6181..6360 CDD:292572
DUF4696 6339..6999 CDD:292395
DUF4758 6662..6839 CDD:292572
DUF4758 6764..6941 CDD:292572
DUF4758 6866..7045 CDD:292572
DUF4758 6968..7179 CDD:292572
DUF4696 7024..7569 CDD:292395
DUF4758 7172..7383 CDD:292572
DUF4696 7330..7964 CDD:292395
DUF4758 7400..7587 CDD:292572
DUF4758 7538..7707 CDD:292572
DUF4758 7798..7979 CDD:292572
DUF4758 7946..8126 CDD:292572
YppG 18767..>18832 CDD:290883
Med25_SD1 18795..18955 CDD:288132
MISS 19026..19258 CDD:292450
ZP 22576..22811 CDD:214579
Zona_pellucida <22714..22810 CDD:278526
Matn2NP_001345709.1 vWA_Matrilin 54..276 CDD:238752 13/43 (30%)
FXa_inhibition 283..318 CDD:317114 13/34 (38%)
FXa_inhibition 324..359 CDD:317114 10/42 (24%)
FXa_inhibition 365..400 CDD:317114 11/36 (31%)
FXa_inhibition 406..441 CDD:317114 11/36 (31%)
vWFA <438..481 CDD:320736 15/43 (35%)
FXa_inhibition 488..523 CDD:317114 16/68 (24%)
vWFA <520..563 CDD:320736 12/51 (24%)
FXa_inhibition 570..605 CDD:317114 9/34 (26%)
vWFA <602..644 CDD:320736 11/43 (26%)
vWFA 652..892 CDD:320736 4/34 (12%)
Matrilin_ccoil 911..953 CDD:313592
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.