powered by:
Protein Alignment dpy and KRT28
DIOPT Version :9
Sequence 1: | NP_001260032.1 |
Gene: | dpy / 318824 |
FlyBaseID: | FBgn0053196 |
Length: | 22949 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_853513.2 |
Gene: | KRT28 / 162605 |
HGNCID: | 30842 |
Length: | 464 |
Species: | Homo sapiens |
Alignment Length: | 92 |
Identity: | 24/92 - (26%) |
Similarity: | 30/92 - (32%) |
Gaps: | 35/92 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 3464 RNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGG---CSSKPCGENSKCTEVPG 3525
|:.||..|| ...|||.|| ..|..||.:...:|
Human 10 RHVCLRSGA---------------------------GSVRPLNGGAGFAGSSACGGSVAGSE--- 44
Fly 3526 GYECACMDGCIGDAHQGCLCGGPLVNA 3552
:.|| :.|.:|....|...||.|.||
Human 45 -FSCA-LGGGLGSVPGGSHAGGALGNA 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.