DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpy and hhat

DIOPT Version :9

Sequence 1:	NP_001260032.1	Gene:	dpy / 318824	FlyBaseID:	FBgn0053196	Length:	22949	Species:	Drosophila melanogaster
Sequence 2:	XP_031758458.1	Gene:	hhat / 100490766	XenbaseID:	XB-GENE-1011720	Length:	535	Species:	Xenopus tropicalis

Alignment Length:	44	Identity:	12/44 - (27%)
Similarity:	14/44 - (31%)	Gaps:	16/44 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly 12913 CRELNGQAVCSCLELYI----------------GLPPNCRPECV 12940
            |..|.|.|:...|..|:                ||.|...|.||
Frog   309 CWALGGLALAQVLFFYVKYLVLYGLPALIVRLDGLDPPALPRCV 352

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpy	NP_001260032.1	EGF_3	137..166	CDD:289699
		EGF_CA	212..247	CDD:238011
		EGF_CA	255..>286	CDD:214542
		EGF_CA	298..331	CDD:238011
		EGF_CA	338..373	CDD:238011
		EGF_CA	413..456	CDD:238011
		EGF_CA	457..490	CDD:238011
		EGF_CA	497..>529	CDD:214542
		EGF_CA	580..>612	CDD:214542
		EGF_3	676..702	CDD:289699
		EGF_CA	1022..1056	CDD:214542
		EGF_CA	2227..2260	CDD:238011
		EGF_CA	2393..>2422	CDD:214542
		DUF4758	4088..4282	CDD:292572
		DUF4696	4127..4678	CDD:292395
		DUF4758	4275..4448	CDD:292572
		DUF4758	4377..4574	CDD:292572
		DUF4758	4581..4754	CDD:292572
		DUF4758	4683..4847	CDD:292572
		DUF4758	4785..4964	CDD:292572
		DUF4696	4841..5385	CDD:292395
		DUF4758	4887..5098	CDD:292572
		DUF4758	5193..5371	CDD:292572
		DUF4758	5294..5487	CDD:292572
		DUF4758	5445..5650	CDD:292572
		DUF4758	5700..5877	CDD:292572
		DUF4696	5756..6396	CDD:292395
		DUF4758	5802..5979	CDD:292572
		DUF4758	5964..6171	CDD:292572
		DUF4758	6181..6360	CDD:292572
		DUF4696	6339..6999	CDD:292395
		DUF4758	6662..6839	CDD:292572
		DUF4758	6764..6941	CDD:292572
		DUF4758	6866..7045	CDD:292572
		DUF4758	6968..7179	CDD:292572
		DUF4696	7024..7569	CDD:292395
		DUF4758	7172..7383	CDD:292572
		DUF4696	7330..7964	CDD:292395
		DUF4758	7400..7587	CDD:292572
		DUF4758	7538..7707	CDD:292572
		DUF4758	7798..7979	CDD:292572
		DUF4758	7946..8126	CDD:292572
		YppG	18767..>18832	CDD:290883
		Med25_SD1	18795..18955	CDD:288132
		MISS	19026..19258	CDD:292450
		ZP	22576..22811	CDD:214579
		Zona_pellucida	<22714..22810	CDD:278526
hhat	XP_031758458.1	MBOAT	163..426	CDD:382173	12/44 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910