powered by:
Protein Alignment dpy and zgc:172106
DIOPT Version :9
Sequence 1: | NP_001260032.1 |
Gene: | dpy / 318824 |
FlyBaseID: | FBgn0053196 |
Length: | 22949 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001108035.2 |
Gene: | zgc:172106 / 100136844 |
ZFINID: | ZDB-GENE-080204-42 |
Length: | 396 |
Species: | Danio rerio |
Alignment Length: | 120 |
Identity: | 26/120 - (21%) |
Similarity: | 35/120 - (29%) |
Gaps: | 60/120 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 11441 RPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVT 11505
|...|.::| |||...||: |..:|: ||.
Zfish 324 RKRVTRSEE-QNHRGSQQQ----------------QQQKHS---------------------AVE 350
Fly 11506 PTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDD 11560
|.|.|....: |::.|.| ||.....:|.|||.||
Zfish 351 PPEDPYMALD-----PNSRCSE-----------------YDTLDNLKRSCENTDD 383
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4475 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.