DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpy and hmcn1

DIOPT Version :9

Sequence 1:NP_001260032.1 Gene:dpy / 318824 FlyBaseID:FBgn0053196 Length:22949 Species:Drosophila melanogaster
Sequence 2:XP_012816895.2 Gene:hmcn1 / 100135378 XenbaseID:XB-GENE-6258572 Length:5519 Species:Xenopus tropicalis


Alignment Length:1246 Identity:284/1246 - (22%)
Similarity:392/1246 - (31%) Gaps:460/1246 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPLVTW------------IVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEV----FYLNLENGY 53
            :|.:||            |.:|.::::....:|:........:|.:....:|    |.:.:..|:
 Frog  4469 VPTITWYRRNNPISSEDRITILPNNSLQIVSAQKEDTSVYECKATNIMGTDVVKVTFTVQVHGGF 4533

  Fly    54 FGCQVNESTEYLQLFNLS-----------KLCD------GTQDCFLGADELSKELKCTND-CDKD 100
                    :|:|...:.|           :|||      |...| .||:  ::...|.|. |..|
 Frog  4534 --------SEWLPWQSCSVTCGQGIQQRIRLCDNPLPANGGNYC-QGAE--TETRSCQNKLCPVD 4587

  Fly   101 GT--------KCTHGACLNG----VCHCND---GYGGCNCVDK--DENECKQRPCDV-------- 140
            |.        :|:. :|.:|    |..|:|   ..||..|:.|  |...|..:||.|        
 Frog  4588 GNWSEWSTWEECSR-SCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPCPVHGMWGPWQ 4651

  Fly   141 -FAHCTNTLGSFT------CTCFPGYRGNGFHCEDIDE----CQDPAIAARCVENAE-------- 186
             :..||.|.|..|      |. .|....:|..||..|.    |.|    .:|..:.:        
 Frog  4652 SWGACTKTCGKGTKMRVRLCN-NPAPSPDGLPCEGQDTQMQICGD----RQCPVDGKWSAWGSWT 4711

  Fly   187 CCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYRE 251
            .|:|      .|..|       |......|.||   .|..      |.:.|.      ||....|
 Frog  4712 SCSL------SCGGG-------LRQRTRACSNP---APQY------GGHKCE------GNEHENE 4748

  Fly   252 GCQDVDECSYPNVCGP----GAICTNLEGS----YR-CDCP-PGYDGDGRSESGCVDQDECARTP 306
            .| :.|.|......||    |:......|.    || ||.| |.:.|..           |..|.
 Frog  4749 MC-NADLCPVHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRA-----------CTGTD 4801

  Fly   307 CGRNADCLNTDGSFRCLCP-DGYSGDPMNGCEDVDECATNNPCGLGAE-----CVNLGGSFQCR- 364
            ...| .| |||     ||| .|..|.    .|...:|:.:  ||.|.:     |.:...|:..| 
 Frog  4802 TETN-KC-NTD-----LCPAHGNWGQ----WEAWSKCSVS--CGGGEQIRTRVCHHPARSYTGRP 4853

  Fly   365 CPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSG----------AGLACLDIDECNQ 419
            ||.        .:.||.: .|.|....||        ||..|          .|:|.|:....:.
 Frog  4854 CPG--------DSTQLLR-CNVQACPGGP--------QRVKGNLFGRINDLDFGMAPLNATITDD 4901

  Fly   420 PDGVAKCGTNAKCINFPGSYRCLCPS------------------------GFQGQGYL------- 453
            |:..::. ..||..|.|.|   |.||                        ||...|.:       
 Frog  4902 PNSGSRI-LQAKFTNIPKS---LGPSMRNLVSLLNPIYWTTAKEIGEAVNGFSLTGGIFKRESQV 4962

  Fly   454 -----HCENINECQDNPCGENAICTDTV--------GSFVCTCKPDYTGDPFRGCVDIDECTALD 505
                 ....|.........:.::..|||        .:.|.....|||.|..:           .
 Frog  4963 EFATGEILKITHTARGVESDGSLLLDTVVKGNVLQLQTSVDIHLKDYTEDYIQ-----------T 5016

  Fly   506 KPCGQHAVCEN--TVPG----YNCKCPQGYD-GKPDPKVACEQVDVNILCSSNFDCTNNAECIEN 563
            .|...||....  :|.|    |.......|| |:.......|.:.||   |...|.....|.:..
 Frog  5017 GPGQVHAYSTRMFSVDGVYVPYTWNHTINYDAGQGTMPFLTETLQVN---SIETDYNPQEESLSF 5078

  Fly   564 QCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV 628
            |                     .||.:         :.|....:|.:|:                
 Frog  5079 Q---------------------VHASI---------SRGDLSIQCPSGF---------------- 5097

  Fly   629 RCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTC 693
                    ..|....||..||           .|.....|            :.:|.|:.|.:.|
 Frog  5098 --------SLDSTGLYCTDED-----------ECASSSPC------------SHSCHNNIGSYYC 5131

  Fly   694 ACPPGFS-GDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVS 757
            :||.|.. .|....|.|:|||....|.|....||.|.. |.|.|            .|:|.....
 Frog  5132 SCPRGLMISDDGRTCHDIDECTLEDSICRKNQECKNTV-GSYIC------------GVKCGVGFR 5183

  Fly   758 CSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSA 822
            .:||:     .:|.....||  |.|       ||       |.:|:.:.|...|.|..||    .
 Frog  5184 AAAND-----LVCQDINECL--ESN-------PC-------HQRCLNSIGSYHCGCDTGY----Q 5223

  Fly   823 LAG-GCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGE 886
            |.| .|.|::|||...|.:..:|.||.|.|.|                                 
 Frog  5224 LKGRRCIDLNECRHGVCRQDQLCKNTRGSYKC--------------------------------- 5255

  Fly   887 TCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHN 951
                       :.:|..|..| :|||.|.|::||  |.|...|..|.:|:|..|.|.|.||:|:.
 Frog  5256 -----------IDVCPIGLTR-AENGTCVDINEC--QDGTHLCKNNQICENTLGGYLCTCPRGYK 5306

  Fly   952 GNPFIMCEICNTPECQCQSPYKLVGNSCV-LSGCSSGQACPSGAECISIAGGVSY-CACPKGYQT 1014
            ...                    .|:.|| ::.|..|..|..  ||.::.|  || |.||.|||.
 Frog  5307 SEG--------------------AGSPCVDINECEKGDVCQH--ECRNVLG--SYKCLCPPGYQL 5347

  Fly  1015 QPDG-SCVDVDECEERGAQLCAFGAQCVNKPGSYSC---HCPEGYQGDAYNGLCALAQRKCAA-D 1074
            ..:| :|.|:|||.|:..| |.....|.|..||:.|   .||..|..|..:|.|.   :.||. |
 Frog  5348 MANGKTCQDIDECLEQNIQ-CGMNRMCFNMRGSHQCIDTPCPPNYIRDTISGYCL---KNCAPND 5408

  Fly  1075 RECAANEKCIQ 1085
            .|||.:...:|
 Frog  5409 LECALSPYALQ 5419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpyNP_001260032.1 EGF_3 137..166 CDD:289699 11/43 (26%)
EGF_CA 212..247 CDD:238011 7/34 (21%)
EGF_CA 255..>286 CDD:214542 12/40 (30%)
EGF_CA 298..331 CDD:238011 11/33 (33%)
EGF_CA 338..373 CDD:238011 9/40 (23%)
EGF_CA 413..456 CDD:238011 12/78 (15%)
EGF_CA 457..490 CDD:238011 8/40 (20%)
EGF_CA 497..>529 CDD:214542 6/37 (16%)
EGF_CA 580..>612 CDD:214542 4/31 (13%)
EGF_3 676..702 CDD:289699 7/26 (27%)
EGF_CA 1022..1056 CDD:214542 14/36 (39%)
EGF_CA 2227..2260 CDD:238011
EGF_CA 2393..>2422 CDD:214542
DUF4758 4088..4282 CDD:292572
DUF4696 4127..4678 CDD:292395
DUF4758 4275..4448 CDD:292572
DUF4758 4377..4574 CDD:292572
DUF4758 4581..4754 CDD:292572
DUF4758 4683..4847 CDD:292572
DUF4758 4785..4964 CDD:292572
DUF4696 4841..5385 CDD:292395
DUF4758 4887..5098 CDD:292572
DUF4758 5193..5371 CDD:292572
DUF4758 5294..5487 CDD:292572
DUF4758 5445..5650 CDD:292572
DUF4758 5700..5877 CDD:292572
DUF4696 5756..6396 CDD:292395
DUF4758 5802..5979 CDD:292572
DUF4758 5964..6171 CDD:292572
DUF4758 6181..6360 CDD:292572
DUF4696 6339..6999 CDD:292395
DUF4758 6662..6839 CDD:292572
DUF4758 6764..6941 CDD:292572
DUF4758 6866..7045 CDD:292572
DUF4758 6968..7179 CDD:292572
DUF4696 7024..7569 CDD:292395
DUF4758 7172..7383 CDD:292572
DUF4696 7330..7964 CDD:292395
DUF4758 7400..7587 CDD:292572
DUF4758 7538..7707 CDD:292572
DUF4758 7798..7979 CDD:292572
DUF4758 7946..8126 CDD:292572
YppG 18767..>18832 CDD:290883
Med25_SD1 18795..18955 CDD:288132
MISS 19026..19258 CDD:292450
ZP 22576..22811 CDD:214579
Zona_pellucida <22714..22810 CDD:278526
hmcn1XP_012816895.2 Ig strand A 2010..2015 CDD:409353
I-set 2011..2099 CDD:400151
Ig strand A' 2019..2025 CDD:409353
Ig strand B 2026..2036 CDD:409353
Ig strand C 2040..2046 CDD:409353
Ig strand C' 2048..2050 CDD:409353
Ig strand D 2057..2060 CDD:409353
Ig strand E 2065..2071 CDD:409353
Ig strand F 2077..2086 CDD:409353
Ig strand G 2089..2101 CDD:409353
Ig_3 2102..2177 CDD:404760
Ig strand A 2102..2105 CDD:409353
Ig strand A' 2111..2114 CDD:409353
Ig strand B 2120..2127 CDD:409353
Ig strand C 2133..2138 CDD:409353
Ig strand C' 2141..2143 CDD:409353
Ig strand D 2149..2153 CDD:409353
Ig strand E 2155..2160 CDD:409353
Ig strand F 2169..2177 CDD:409353
Ig strand G 2180..2190 CDD:409353
Ig 2194..2285 CDD:416386
Ig strand A 2194..2197 CDD:409353
Ig strand A' 2202..2207 CDD:409353
Ig strand B 2213..2220 CDD:409353
Ig strand C 2226..2231 CDD:409353
Ig strand C' 2233..2235 CDD:409353
Ig strand D 2243..2247 CDD:409353
Ig strand E 2251..2257 CDD:409353
Ig strand F 2264..2271 CDD:409353
Ig strand G 2277..2285 CDD:409353
Ig_3 2288..2366 CDD:404760
Ig strand A' 2300..2304 CDD:409353
Ig strand B 2308..2315 CDD:409353
Ig strand C 2322..2327 CDD:409353
Ig strand C' 2329..2332 CDD:409353
Ig strand D 2337..2341 CDD:409353
Ig strand E 2344..2351 CDD:409353
Ig strand F 2358..2366 CDD:409353
Ig strand B 2403..2407 CDD:409353
Ig 2404..2473 CDD:416386
Ig strand C 2416..2420 CDD:409353
Ig strand E 2439..2443 CDD:409353
Ig strand F 2453..2458 CDD:409353
I-set 2477..2565 CDD:400151
Ig strand B 2495..2499 CDD:409353
Ig strand C 2508..2512 CDD:409353
Ig strand E 2531..2535 CDD:409353
Ig strand F 2545..2550 CDD:409353
Ig 2579..2660 CDD:416386
Ig strand A' 2579..2584 CDD:409353
Ig strand B 2590..2597 CDD:409353
Ig strand C 2603..2608 CDD:409353
Ig strand C' 2610..2612 CDD:409353
Ig strand D 2619..2622 CDD:409353
Ig strand E 2626..2632 CDD:409353
Ig strand F 2639..2646 CDD:409353
Ig strand G 2652..2660 CDD:409353
I-set 2673..2758 CDD:400151
Ig strand B 2689..2693 CDD:409353
Ig strand C 2702..2706 CDD:409353
Ig strand E 2725..2728 CDD:409353
Ig strand F 2738..2743 CDD:409353
Ig strand B 2794..2798 CDD:409353
Ig 2795..2857 CDD:416386
Ig strand C 2807..2811 CDD:409353
Ig strand E 2830..2834 CDD:409353
Ig strand F 2844..2849 CDD:409353
I-set 2878..2961 CDD:400151
Ig strand A' 2886..2889 CDD:409353
Ig strand C 2904..2909 CDD:409353
Ig strand C' 2911..2913 CDD:409353
Ig strand D 2919..2923 CDD:409353
Ig strand E 2926..2932 CDD:409353
Ig strand F 2940..2948 CDD:409353
Ig_3 2964..3040 CDD:404760
Ig strand A 2967..2970 CDD:409353
Ig strand A' 2974..2977 CDD:409353
Ig strand B 2983..2990 CDD:409353
Ig strand C 2996..3001 CDD:409353
Ig strand D 3011..3015 CDD:409353
Ig strand E 3018..3024 CDD:409353
Ig strand F 3032..3040 CDD:409353
Ig strand G 3043..3053 CDD:409353
Ig strand A 3056..3061 CDD:409353
Ig strand A' 3067..3073 CDD:409353
I-set 3070..3148 CDD:400151
Ig strand B 3076..3086 CDD:409353
Ig strand C 3090..3096 CDD:409353
Ig strand C' 3098..3100 CDD:409353
Ig strand D 3106..3109 CDD:409353
Ig strand E 3114..3120 CDD:409353
Ig strand F 3126..3135 CDD:409353
Ig strand G 3138..3150 CDD:409353
Ig 3169..3242 CDD:416386
Ig strand B 3170..3174 CDD:409353
Ig strand C 3183..3187 CDD:409353
Ig strand E 3208..3212 CDD:409353
Ig strand F 3222..3227 CDD:409353
Ig strand A 3245..3250 CDD:409353
Ig strand A' 3254..3260 CDD:409353
I-set 3259..3329 CDD:400151
Ig strand B 3263..3273 CDD:409353
Ig strand C 3277..3283 CDD:409353
Ig strand C' 3285..3287 CDD:409353
Ig strand D 3295..3298 CDD:409353
Ig strand E 3303..3309 CDD:409353
Ig strand F 3315..3324 CDD:409353
Ig strand G 3327..3339 CDD:409353
I-set 3341..3431 CDD:400151
Ig strand B 3361..3368 CDD:409353
Ig strand C 3374..3379 CDD:409353
Ig strand C' 3381..3383 CDD:409353
Ig strand D 3389..3393 CDD:409353
Ig strand E 3397..3402 CDD:409353
Ig strand F 3411..3417 CDD:409353
Ig 3444..3524 CDD:416386
Ig strand A' 3445..3448 CDD:409353
Ig strand B 3454..3461 CDD:409353
Ig strand C 3467..3472 CDD:409353
Ig strand C' 3474..3476 CDD:409353
Ig strand D 3481..3486 CDD:409353
Ig strand E 3489..3495 CDD:409353
Ig strand F 3503..3511 CDD:409353
Ig strand G 3514..3524 CDD:409353
Ig strand A 3527..3532 CDD:409353
Ig strand A' 3536..3542 CDD:409353
Ig 3539..3617 CDD:416386
Ig strand B 3545..3555 CDD:409353
Ig strand C 3559..3565 CDD:409353
Ig strand C' 3567..3569 CDD:409353
vWFA 43..199 CDD:238119
MD 295..418 CDD:214741
IGc2 446..507 CDD:197706
Ig strand B 449..452 CDD:409353
Ig strand C 461..465 CDD:409353
Ig strand E 483..487 CDD:409353
Ig strand F 497..502 CDD:409353
Ig strand G 511..514 CDD:409353
Ig 521..608 CDD:416386
Ig strand A' 529..532 CDD:409353
Ig strand B 538..545 CDD:409353
Ig strand C 551..556 CDD:409353
Ig strand C' 558..560 CDD:409353
Ig strand D 568..572 CDD:409353
Ig strand E 575..580 CDD:409353
Ig strand F 588..596 CDD:409353
Ig strand G 599..607 CDD:409353
I-set 613..691 CDD:400151
Ig strand A' 621..624 CDD:409353
Ig strand B 630..637 CDD:409353
Ig strand C 643..648 CDD:409353
Ig strand C' 650..652 CDD:409353
Ig strand D 658..663 CDD:409353
Ig strand E 665..669 CDD:409353
Ig strand F 678..686 CDD:409353
Ig strand G 689..700 CDD:409353
Ig_3 703..777 CDD:404760
Ig strand A' 709..714 CDD:409353
Ig strand B 718..725 CDD:409353
Ig strand C 733..737 CDD:409353
Ig strand D 749..752 CDD:409353
Ig strand E 756..761 CDD:409353
Ig strand F 769..777 CDD:409353
Ig strand G 783..790 CDD:409353
I-set 794..885 CDD:400151
Ig strand A 794..797 CDD:409353
Ig strand A' 802..805 CDD:409353
Ig strand B 811..818 CDD:409353
Ig strand C 824..835 CDD:409353
Ig strand C' 838..840 CDD:409353
Ig strand D 845..849 CDD:409353
Ig strand E 851..855 CDD:409353
Ig strand F 864..872 CDD:409353
Ig strand G 875..885 CDD:409353
Ig_3 891..965 CDD:404760
Ig strand A' 899..901 CDD:409353
Ig strand B 907..915 CDD:409353
Ig strand C 922..927 CDD:409353
Ig strand C' 929..932 CDD:409353
Ig strand D 937..941 CDD:409353
Ig strand E 944..950 CDD:409353
Ig strand F 957..965 CDD:409353
Ig strand G 968..972 CDD:409353
Ig strand G' 974..978 CDD:409353
PHA02785 991..1258 CDD:165149
Ig 1268..1355 CDD:416386
Ig strand A' 1272..1275 CDD:409353
Ig strand B 1284..1291 CDD:409353
Ig strand C 1297..1302 CDD:409353
Ig strand C' 1305..1307 CDD:409353
Ig strand D 1313..1319 CDD:409353
Ig strand E 1321..1325 CDD:409353
Ig strand F 1334..1342 CDD:409353
Ig strand G 1345..1355 CDD:409353
Ig 1366..1448 CDD:416386
Ig strand B 1378..1382 CDD:409353
Ig strand C 1391..1395 CDD:409353
Ig strand E 1413..1418 CDD:409353
Ig strand F 1428..1433 CDD:409353
Ig strand G 1442..1445 CDD:409353
I-set 1457..1542 CDD:400151
Ig strand A' 1462..1465 CDD:409353
Ig strand B 1471..1478 CDD:409353
Ig strand C 1484..1489 CDD:409353
Ig strand C' 1491..1493 CDD:409353
Ig strand D 1500..1504 CDD:409353
Ig strand E 1507..1513 CDD:409353
Ig strand F 1521..1529 CDD:409353
Ig strand G 1532..1542 CDD:409353
Ig 1565..1629 CDD:416386
Ig strand B 1565..1569 CDD:409353
Ig strand C 1578..1582 CDD:409353
Ig strand E 1601..1605 CDD:409353
Ig strand F 1615..1620 CDD:409353
I-set 1649..1729 CDD:400151
Ig strand B 1659..1666 CDD:409353
Ig strand C 1672..1677 CDD:409353
Ig strand D 1688..1691 CDD:409353
Ig strand E 1695..1701 CDD:409353
Ig strand F 1708..1715 CDD:409353
Ig strand G 1721..1729 CDD:409353
I-set 1741..1822 CDD:400151
Ig strand A' 1743..1746 CDD:409353
Ig strand B 1752..1759 CDD:409353
Ig strand C 1765..1770 CDD:409353
Ig strand C' 1772..1774 CDD:409353
Ig strand D 1780..1784 CDD:409353
Ig strand E 1787..1793 CDD:409353
Ig strand F 1801..1809 CDD:409353
Ig <1844..1914 CDD:416386
Ig strand C 1856..1860 CDD:409353
Ig strand C' 1863..1866 CDD:409353
Ig strand D 1872..1876 CDD:409353
Ig strand E 1880..1885 CDD:409353
Ig strand F 1893..1901 CDD:409353
Ig strand G 1904..1914 CDD:409353
Ig 1937..2007 CDD:416386
Ig strand B 1937..1941 CDD:409353
Ig strand C 1950..1954 CDD:409353
Ig strand E 1973..1977 CDD:409353
Ig strand F 1987..1992 CDD:409353
Ig strand D 3576..3579 CDD:409353
Ig strand E 3583..3589 CDD:409353
Ig strand F 3595..3604 CDD:409353
Ig strand G 3607..3617 CDD:409353
I-set 3630..3710 CDD:400151
Ig strand A' 3631..3634 CDD:409353
Ig strand B 3640..3647 CDD:409353
Ig strand C 3653..3658 CDD:409353
Ig strand C' 3660..3662 CDD:409353
Ig strand D 3668..3672 CDD:409353
Ig strand E 3675..3681 CDD:409353
Ig strand F 3689..3697 CDD:409353
Ig_3 3713..3788 CDD:404760
Ig strand A' 3722..3725 CDD:409353
Ig strand B 3731..3738 CDD:409353
Ig strand C 3744..3749 CDD:409353
Ig strand C' 3751..3753 CDD:409353
Ig strand D 3760..3764 CDD:409353
Ig strand E 3767..3772 CDD:409353
Ig strand F 3780..3788 CDD:409353
Ig strand G 3791..3801 CDD:409353
Ig_3 3804..3879 CDD:404760
Ig strand B 3823..3826 CDD:409353
Ig strand C 3835..3839 CDD:409353
Ig strand E 3860..3864 CDD:409353
Ig strand F 3874..3879 CDD:409353
Ig strand A' 3906..3909 CDD:409353
Ig 3908..3985 CDD:416386
Ig strand B 3915..3922 CDD:409353
Ig strand C 3928..3933 CDD:409353
Ig strand C' 3935..3937 CDD:409353
Ig strand D 3944..3948 CDD:409353
Ig strand E 3951..3956 CDD:409353
Ig strand F 3964..3972 CDD:409353
Ig strand G 3975..3985 CDD:409353
I-set 3989..4075 CDD:400151
Ig strand B 4006..4013 CDD:409353
Ig strand C 4019..4024 CDD:409353
Ig strand C' 4026..4028 CDD:409353
Ig strand D 4034..4038 CDD:409353
Ig strand E 4041..4046 CDD:409353
Ig strand F 4054..4062 CDD:409353
Ig strand G 4065..4075 CDD:409353
Ig_3 4078..4152 CDD:404760
Ig strand C 4109..4113 CDD:409353
Ig strand C' 4116..4119 CDD:409353
Ig strand D 4126..4129 CDD:409353
Ig strand E 4131..4136 CDD:409353
Ig strand F 4144..4152 CDD:409353
Ig strand G 4155..4165 CDD:409353
Ig strand A 4168..4171 CDD:409353
I-set 4169..4256 CDD:400151
Ig strand A' 4177..4180 CDD:409353
Ig strand B 4185..4193 CDD:409353
Ig strand C 4199..4203 CDD:409353
Ig strand C' 4206..4209 CDD:409353
Ig strand D 4215..4219 CDD:409353
Ig strand E 4222..4227 CDD:409353
Ig strand F 4235..4243 CDD:409353
Ig strand G 4246..4256 CDD:409353
Ig_3 4259..4333 CDD:404760
putative Ig strand A 4260..4266 CDD:409353
Ig strand B 4277..4281 CDD:409353
Ig strand C 4290..4295 CDD:409353
Ig strand E 4312..4316 CDD:409353
Ig strand F 4326..4331 CDD:409353
Ig strand G 4339..4342 CDD:409353
Ig 4358..4436 CDD:416386
Ig strand B 4368..4375 CDD:409353
Ig strand C 4381..4386 CDD:409353
Ig strand C' 4388..4390 CDD:409353
Ig strand D 4396..4400 CDD:409353
Ig strand E 4403..4408 CDD:409353
Ig strand F 4416..4424 CDD:409353
Ig strand G 4427..4436 CDD:409353
Ig 4443..4527 CDD:416386 9/57 (16%)
Ig strand A' 4449..4452 CDD:409353
Ig strand B 4458..4465 CDD:409353
Ig strand C 4471..4476 CDD:409353 2/4 (50%)
Ig strand C' 4478..4480 CDD:409353 0/1 (0%)
Ig strand D 4486..4490 CDD:409353 1/3 (33%)
Ig strand E 4493..4498 CDD:409353 0/4 (0%)
Ig strand F 4506..4514 CDD:409353 1/7 (14%)
Ig strand G 4517..4527 CDD:409353 2/9 (22%)
TSP1 4534..4585 CDD:214559 12/53 (23%)
TSP1 4590..4642 CDD:214559 13/52 (25%)
TSP1 4647..4699 CDD:214559 13/56 (23%)
TSP1 4704..4756 CDD:214559 16/80 (20%)
TSP1 4761..4813 CDD:214559 19/69 (28%)
TSP1 4818..4870 CDD:214559 15/66 (23%)
nidG2 4869..5093 CDD:412205 48/279 (17%)
cEGF 5128..5151 CDD:403760 7/22 (32%)
EGF_CA 5148..5183 CDD:214542 14/47 (30%)
EGF_CA 5193..5230 CDD:214542 15/56 (27%)
EGF_CA 5231..5272 CDD:214542 17/85 (20%)
EGF_CA 5273..5314 CDD:311536 16/62 (26%)
EGF_CA 5316..5355 CDD:214542 15/42 (36%)
EGF_CA 5356..>5391 CDD:214542 14/35 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.