DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aladin and AAAS

DIOPT Version :9

Sequence 1:NP_001285049.1 Gene:Aladin / 31881 FlyBaseID:FBgn0030122 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_011537080.1 Gene:AAAS / 8086 HGNCID:13666 Length:560 Species:Homo sapiens


Alignment Length:498 Identity:149/498 - (29%)
Similarity:227/498 - (45%) Gaps:78/498 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QCPPFSTLPDLALRHNHIPELERYPQINLNSELLANPAGQRYYGGQ-SFVSVNEGVLKRIARSFF 72
            :.||    ||...:..::|.|:      |..:.|..| |:..:|.: :|:...|.|.||....:.
Human    32 ESPP----PDFRGQWINLPVLQ------LTKDPLKTP-GRLDHGTRTAFIHHREQVWKRCINIWR 85

  Fly    73 NGGFWKTLEEARSPETREQAPLIAQAGDLIAQFLGLATGL-------------RILPHTQQLSAE 124
            :.|.:..|.|            ||.:.:.:.:::..|:|.             .:.||....|.:
Human    86 DVGLFGVLNE------------IANSEEEVFEWVKTASGWALALCRWASSLHGSLFPHLSLRSED 138

  Fly   125 RIAQFVETRDWLNSDVRYLAWNQHFFCLAVAGVDDVVRIYTKSSSATTATVLKSPSQTQITCMAW 189
            .||:|.:..:|.:..:|..||:.|....|||.:||.||:|  ::|:|....||...|..:..:||
Human   139 LIAEFAQVTNWSSCCLRVFAWHPHTNKFAVALLDDSVRVY--NASSTIVPSLKHRLQRNVASLAW 201

  Fly   190 RPLCASEIVIGCRQGLCFWEVDST-LHLGRTNAPSEIFKYPNNLPITSMQWNKDGTQLATASIGD 253
            :||.||.:.:.|:..:..|.:|.| |....::..:::..:|.:.|:||:.|...|.:|.:||..|
Human   202 KPLSASVLAVACQSCILIWTLDPTSLSTRPSSGCAQVLSHPGHTPVTSLAWAPSGGRLLSASPVD 266

  Fly   254 RSIIIWQPDTGMMQPLK--RLGPPGSLLKWSPDNDWLFAATVDRVFRVWNCHQQWTTERWVCGP- 315
            .:|.:|...|....||.  |.|...:|| ||||...:.|.|...|||||.. |.||.|||   | 
Human   267 AAIRVWDVSTETCVPLPWFRGGGVTNLL-WSPDGSKILATTPSAVFRVWEA-QMWTCERW---PT 326

  Fly   316 -GGYVQTACWSPCGRFLLFVSSAEPILYRLQFVQQSLLSSS--ADEKEILPIADLNACSI---DA 374
             .|..||.||||.|..|||....||::|.|.|.::......  ...|....:|||:..:|   |.
Human   327 LSGRCQTGCWSPDGSRLLFTVLGEPLIYSLSFPERCGEGKGCVGGAKSATIVADLSETTIQTPDG 391

  Fly   375 NRTLVGGPAQQLAWDPHGNYLVVTFK-------ATNCIAVFRTFIQK-FD------------LQI 419
            ...| ||.|..:.|||.|..|.|..|       ....|.:|||.... |:            |..
Human   392 EERL-GGEAHSMVWDPSGERLAVLMKGKPRVQDGKPVILLFRTRNSPVFELLPCSLLASGCLLTF 455

  Fly   420 SAAYYLSGETAAEHPSFICFQPLYEDNDRSVLTIAWSSGRIQY 462
            |::..:.||..|: |..|.|.|.:  |..::|::.||:|||.:
Human   456 SSSGIIQGEPGAQ-PQLITFHPSF--NKGALLSVGWSTGRIAH 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AladinNP_001285049.1 WD40 <130..>420 CDD:225201 105/319 (33%)
WD40 repeat 137..177 CDD:293791 14/39 (36%)
WD40 repeat 184..227 CDD:293791 11/43 (26%)
WD40 repeat 235..274 CDD:293791 14/40 (35%)
WD40 repeat 276..312 CDD:293791 18/35 (51%)
WD40 repeat 320..357 CDD:293791 15/38 (39%)
WD40 repeat 364..400 CDD:293791 15/38 (39%)
WD40 repeat 407..441 CDD:293791 12/46 (26%)
AAASXP_011537080.1 WD40 <133..343 CDD:295369 78/216 (36%)
WD40 154..>413 CDD:225201 96/266 (36%)
WD40 repeat 157..193 CDD:293791 15/37 (41%)
WD40 repeat 197..243 CDD:293791 11/45 (24%)
WD40 repeat 247..283 CDD:293791 12/35 (34%)
WD40 repeat 291..328 CDD:293791 20/41 (49%)
WD40 repeat 356..390 CDD:293791 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158866
Domainoid 1 1.000 78 1.000 Domainoid score I8844
eggNOG 1 0.900 - - E1_KOG2139
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9232
Inparanoid 1 1.050 188 1.000 Inparanoid score I3914
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49996
OrthoDB 1 1.010 - - D470197at33208
OrthoFinder 1 1.000 - - FOG0005612
OrthoInspector 1 1.000 - - oto89111
orthoMCL 1 0.900 - - OOG6_104613
Panther 1 1.100 - - LDO PTHR14494
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5823
SonicParanoid 1 1.000 - - X5253
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.