DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi16 and Osi23

DIOPT Version :9

Sequence 1:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:191 Identity:46/191 - (24%)
Similarity:78/191 - (40%) Gaps:37/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QRAESLLSGCEASSFS---WMCLKIEFVKIMEKLAEQEELNVLPGISVVKDENATELKTSELMAE 106
            ::..|.|..|..|...   |.|.:...:.|.|.:....|:::..|:.:|...|:|:..|.     
  Fly    36 KKLRSDLRDCYQSGIHQSLWSCFRSRSLHIFEGIMSSPEISIYDGVRLVAAPNSTDNATR----- 95

  Fly   107 VARSYPSDPSTRLN-----GYIVAKLENLLRTRFLRFRL--LDDKSL------------VEGRKH 152
                 |.|....|.     ..:...|...|.|..|:..|  |.::.|            ...|:|
  Fly    96 -----PDDERKDLKHLTWFDQLAVSLAKGLTTHTLQVNLGKLTERYLSSDTSNPDPVGSARVRRH 155

  Fly   153 KFGKKGGLEALVAAGVMMKG-MLMAMGLGAIALMAGKALMTALMALTLSGVLGLKSLAGGG 212
            ::    .:...:..||...| :|:.||...:::::||||:.|.|||.|:.:.|||.:|..|
  Fly   156 RY----NMIITMMFGVTALGAILVPMGFQMLSIVSGKALLLAKMALLLASINGLKRVANNG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 19/102 (19%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 19/110 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.