DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi16 and Osi15

DIOPT Version :9

Sequence 1:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster


Alignment Length:214 Identity:40/214 - (18%)
Similarity:77/214 - (35%) Gaps:44/214 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EFVKIMEKLAEQEELNVLPGISVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVAKLENLL 131
            :.|.::.:|..:|.:.:..|:.:.:.|:......|    :...|:..            :.|..|
  Fly    30 DLVNMLNRLDSEESVALFGGLRIDRSESGRSFGAS----KAVESFED------------RAERYL 78

  Fly   132 RTRFLRFRLLDD------------KSLVEGRKHKFGKKGGLEALVAAGVMMKGMLMAMGLGAIAL 184
            .|..|......|            :::.|.|..:..|.  |..|:.|..:.|.:::.:....|..
  Fly    79 ETHELNLSFSGDEQDENSENEYTGRAMDESRSKRMKKM--LLPLLLALKLKKAVVVKIMFTIIKF 141

  Fly   185 MAGKALMTALMALTLSGVLGLKS-LAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDGGHSHSPHFA 248
            ::.|||..:.:||.|:|....|. ||......||..|...|:     :..:.|.|        ::
  Fly   142 ISLKALAISFLALILAGATFFKDLLAKKKEHITTAYITGSPL-----NADIVHSD--------WS 193

  Fly   249 AGGGGGGTASGFGYGGYAR 267
            ..|..|.....:.:.|.|:
  Fly   194 RNGQAGAADLAYNHYGLAQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 13/95 (14%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 27/149 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.