DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi16 and Osi12

DIOPT Version :9

Sequence 1:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster


Alignment Length:280 Identity:82/280 - (29%)
Similarity:119/280 - (42%) Gaps:69/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFYLALFAFMCKYATAASVQPTEVPAVAPETIRIPQRAESLLSGCEASSFSWM-CLKIEFVKIME 73
            |..|....|:.....||:.|....|..:|......:....:...|..:...:: |||.:.:..::
  Fly    11 LISLLSVLFLASSCGAATEQLGSPPGPSPSQSAGARTLLRVYDECTRAEAGFVPCLKKKAISFID 75

  Fly    74 KLAEQEELNVLPGISVVKDENATE-LKTSELMAEVARSYPSDPSTRLNGYIVAKLENLLRTRFLR 137
            :||..:.:||..||.:|:.|.|.. ..|||  .|:..|.|...|.|     .|||.|:|..|...
  Fly    76 RLAPIDAINVAEGIKLVRLETAPRPPATSE--NELESSLPRSGSDR-----DAKLTNMLIERLSY 133

  Fly   138 F-----------RLLDD---KSLVEGRKHKFGKKGGLEALVAAGVMMKGMLMAM------GLGAI 182
            |           :|..|   :.|.|||       |.::.::  |:||.||.|.|      .:||:
  Fly   134 FFNGHSLQVSFPKLTSDEIGRGLEEGR-------GKMKKMM--GMMMMGMAMKMMGMIPIAMGAL 189

  Fly   183 ALMAGKALMTALMALTLSGVLGLKSLAGG---GGKSTTYEIVAKPIYTSSHSHSVTHEDGGHSHS 244
            .::|||||:.:.:||.|:|::|||.|..|   ||.|                   ....||    
  Fly   190 YILAGKALIISKIALLLAGIIGLKKLMSGKSSGGSS-------------------GWSSGG---- 231

  Fly   245 PHFAAGGGGGGTASGFGYGG 264
                 ||||||.:||.|.||
  Fly   232 -----GGGGGGWSSGGGGGG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 30/98 (31%)
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.