DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi16 and Osi10b

DIOPT Version :9

Sequence 1:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster


Alignment Length:219 Identity:60/219 - (27%)
Similarity:92/219 - (42%) Gaps:45/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PQRAESLLSGCEASSFSWMCLKIEFVKIMEKLAEQEELNVLPGISVVKDENATELKTSELMAEVA 108
            |:....:::.|...:.:|.||.          :|.|:|  |.|.:   .:|:|...|..|..|..
  Fly    37 PRSLGRIIAHCMGGADAWQCLG----------SESEQL--LDGAT---RDNSTWQITDYLSIEPK 86

  Fly   109 RSYPSDPSTRLNGYIVAKLENLLRTRFLRFRL---------LDD----KSLVEGRKHKFGKKGGL 160
            .......:.|::..:..||..|::.|.||.:|         :||    ..|.:|||.|...|   
  Fly    87 VGISKPETRRMDMGLPGKLLELVQGRALRLQLPRQLTISNAIDDFGSELGLDQGRKKKDKDK--- 148

  Fly   161 EALVAAGVMMKGMLMAMGLGAIALMAGKALMTALMALTLSGVLGLK----SLAGGGGKSTTYEIV 221
            ...:..|::|...|..|.||.:.|:||.|.:.|.:||.:|.:..||    ..:|.||.|.|..:|
  Fly   149 NMAMMGGMIMMATLAQMFLGKVILIAGSAFIMAKIALVISLLGSLKKGSTGHSGSGGGSGTEHVV 213

  Fly   222 AKPIYTSSHSHSVTHEDGGHSHSP 245
            .         || :||.|.|...|
  Fly   214 V---------HS-SHESGWHRSMP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 25/96 (26%)
Osi10bNP_001368993.1 DUF1676 52..195 CDD:400313 44/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.