DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi16 and Osi9

DIOPT Version :9

Sequence 1:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:109/243 - (44%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFAFMCKYATAASVQPTEVPAVAPETIRIPQRAESLLSG-------CEASSFSWMCLKIEFVKIM 72
            :|.|:|.:|..||            |......|:|||:.       |...|.. :|:|...:...
  Fly     1 MFKFVCLFALIAS------------TAAATSEADSLLTSALKMVKDCGERSMV-LCMKERALHYF 52

  Fly    73 EKLAEQEELNVLPGISVVKDEN---ATELKTSELMAEV-ARSYPSDPSTRLNGYIVAKLENLLRT 133
            :  ||..::.:..||::||.:.   ...|...:|..|| ||      ...::..:|.::.....|
  Fly    53 D--AENGDVRLTEGIALVKTDEIPVGRSLNEMQLPEEVEAR------EAEVDSLLVERVARFFGT 109

  Fly   134 RFLRFRLLDD------KSLVEGRKHKFGKKGGLEALVAAGVMMKGMLMAMGLGAIALMAGKALMT 192
            ..|:|::..|      ::|.|.|..|..||..|..|:....:....|:.:.:|.:||::.|||:.
  Fly   110 HTLQFKVPKDSIQDMQRALEESRGKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVI 174

  Fly   193 ALMALTLSGVLGLKSLAGGGGKSTTYEIVAKPIYTSSHSH--SVTHED 238
            ..:||.|||::|||.|.  ..|...||:||.|.|...||:  |:..:|
  Fly   175 GKIALLLSGIIGLKKLL--ESKKENYEVVAHPHYEHEHSYGRSLPSDD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 21/93 (23%)
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.