DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi16 and Osi8

DIOPT Version :9

Sequence 1:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:136/304 - (44%) Gaps:66/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKYLFYL-ALFAFMCKYATAASV-----QPTEVPAVAPETIRIPQRAES---------------- 49
            :||:::: ||....|..::|.|.     .|..:.: ||.    ||...|                
  Fly     2 IKYVWHVAALMIVFCWLSSARSASYQHQNPNSLSS-APR----PQVQNSNPGMGSTGLWKDMSMV 61

  Fly    50 --LLSGCEASSFSWMCLKIEFVKIMEK-LAEQEELNVLPGISVVKDENATE------LKTSELMA 105
              :...|...:.| :|||::.:..:|| ....:.|:::.||..|.....:|      :...::.|
  Fly    62 YRIYQQCSGDNMS-VCLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSGGESEETKRAPISEKDIEA 125

  Fly   106 EVARSYPSDPSTRLNGYIVAKLENLLRTRFLRFRLLDDKSLVEGRKHKFGKKGGLEALVAAGVMM 170
            .:.||..:.... ||..|:.::.|.|:...|:.:..::.:.|||||.|  :|.|..|::...:::
  Fly   126 VLPRSVDAKEQV-LNNMILKRVGNFLQDHTLQVKFDNEANSVEGRKKK--EKKGNGAMIMIPLLL 187

  Fly   171 KGMLMAMGLGAIALMAGKALMTALMALTLSGVLGLKSL--AGGGGKSTTYEIVAKPIYTSSHSHS 233
            .|.::.:..||:|::|||||:.:.:||.|:.::|:|.|  .|||||.:::|:|.           
  Fly   188 GGTIVPLAYGALAMLAGKALIVSKLALVLASIIGIKKLLSGGGGGKESSHEVVV----------- 241

  Fly   234 VTHEDGGHSHSPHFAAGGGGGGTASGFGYGGYARSLKVDQSANK 277
               ..||||          |.|......|.|:..:.|....:.|
  Fly   242 ---SSGGHS----------GWGRELDTAYSGWKPAAKESAGSAK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 22/90 (24%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.