DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi16 and Osi5

DIOPT Version :9

Sequence 1:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster


Alignment Length:176 Identity:55/176 - (31%)
Similarity:82/176 - (46%) Gaps:39/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LNVLPGISVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVAKLENLLRTRFLRFR---LLD 142
            |.|:.|:.:|..:|              .|...:...:..| ::..|...|||..:..:   ||:
  Fly    51 LVVIRGLEIVPLQN--------------NSISDEEPDQEQG-LLDSLSFYLRTHEINVKLADLLE 100

  Fly   143 DKSLV-EGRKHKFGKKGGLEALVAAGVMMKGMLMAMGLGAIALMAGKALMTALMALTLSGVLGLK 206
            |:|.| |.||    |..|...|:|..:|...|:..||||.||.:|.|||..:|:||.::|:||||
  Fly   101 DESQVSEARK----KDKGQGMLLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLK 161

  Fly   207 SLAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDG-GHSHSPHFAAGG 251
            :.|..||:|               |||:::..| ||.|.....:.|
  Fly   162 TAAQHGGES---------------SHSISYVTGEGHHHKRRRRSSG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 19/78 (24%)
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 20/84 (24%)
RCR 184..>201 CDD:304939 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AHF7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.