DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi16 and Osi4

DIOPT Version :9

Sequence 1:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster


Alignment Length:265 Identity:58/265 - (21%)
Similarity:80/265 - (30%) Gaps:97/265 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ATAASVQPTEVPAVAPETIRIPQRAESLLSGCEASSFSWMCLKIEFVKIMEKLAEQEELNVLPGI 87
            |.:..|.|...||..|        |.|:.:.......||.|              ....:.|.|:
  Fly    29 ANSLGVDPEGKPAANP--------AVSVENTDLLDKLSWKC--------------ANNASCLYGV 71

  Fly    88 SVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVAKLENLLRTRFLRFRLLDDKSLVEGRKH 152
            :            :.|||    ||....:.:|..:.:.||..|            |.|    |||
  Fly    72 A------------NGLMA----SYRRGETLKLGLFDLVKLPEL------------DAS----RKH 104

  Fly   153 KFGKKGGLEAL----------VAAGVMMKGMLMA---MGLGAIALMAGKALMTALMALTLSGVLG 204
            |:|...||...          |..|.|:..:..|   .....:||:...:..|..:.:...|:||
  Fly   105 KWGTGRGLSGFMDFVTENAIRVPVGPMVFSVQRAEDDSDYIEVALLKKTSSSTGRLQVNGGGLLG 169

  Fly   205 LKSLAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDGGHSHSPHFAAGGGGGGTASGFG-YGGYARS 268
                 ||||.                        ||:........|||||....|.| .||..|.
  Fly   170 -----GGGGL------------------------GGNGGGGGGLLGGGGGDNGGGGGLLGGRRRH 205

  Fly   269 LKVDQ 273
            ...|:
  Fly   206 QHQDK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 17/83 (20%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.