powered by:
Protein Alignment Cfp1 and kdm7a
DIOPT Version :9
Sequence 1: | NP_572556.1 |
Gene: | Cfp1 / 31880 |
FlyBaseID: | FBgn0030121 |
Length: | 663 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001072664.1 |
Gene: | kdm7a / 780121 |
XenbaseID: | XB-GENE-5900920 |
Length: | 922 |
Species: | Xenopus tropicalis |
Alignment Length: | 48 |
Identity: | 22/48 - (45%) |
Similarity: | 31/48 - (64%) |
Gaps: | 1/48 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 YCICRSS-DCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRCK 108
||:||.. |.|||||.||.|::|:|..|:.:.|.:|..|..|:|..|:
Frog 8 YCVCRQPYDVSRFMIECDICKDWFHSSCVKVEEHQAADIDLYHCPNCE 55
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.