DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cfp1 and bip2

DIOPT Version :9

Sequence 1:NP_572556.1 Gene:Cfp1 / 31880 FlyBaseID:FBgn0030121 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster


Alignment Length:43 Identity:20/43 - (46%)
Similarity:24/43 - (55%) Gaps:1/43 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRC 107
            |...|....|||||||:.|||..|:||| ...|....::||.|
  Fly  1346 CGKVDDGSAMIGCDGCDAWYHWICVGIT-FAPKDNDDWFCRVC 1387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cfp1NP_572556.1 PHD_Cfp1 62..107 CDD:277028 19/41 (46%)
zf-CXXC 178..218 CDD:251032
zf-CpG_bind_C 300..532 CDD:289071
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 19/41 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.