powered by:
Protein Alignment Cfp1 and bip2
DIOPT Version :9
Sequence 1: | NP_572556.1 |
Gene: | Cfp1 / 31880 |
FlyBaseID: | FBgn0030121 |
Length: | 663 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651923.2 |
Gene: | bip2 / 43793 |
FlyBaseID: | FBgn0026262 |
Length: | 1406 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 20/43 - (46%) |
Similarity: | 24/43 - (55%) |
Gaps: | 1/43 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 CRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRC 107
|...|....|||||||:.|||..|:||| ...|....::||.|
Fly 1346 CGKVDDGSAMIGCDGCDAWYHWICVGIT-FAPKDNDDWFCRVC 1387
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45443719 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.