DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cfp1 and Fbxl19

DIOPT Version :9

Sequence 1:	NP_572556.1	Gene:	Cfp1 / 31880	FlyBaseID:	FBgn0030121	Length:	663	Species:	Drosophila melanogaster
Sequence 2:	XP_036008913.1	Gene:	Fbxl19 / 233902	MGIID:	3039600	Length:	696	Species:	Mus musculus

Alignment Length:	142	Identity:	34/142 - (23%)
Similarity:	51/142 - (35%)	Gaps:	29/142 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   164 PPTTAAAKRKNSSAREPKMGKRCGTCEGCRRPNCNQCDACR--VRVG----HKPRCIFRTCVVQA 222
            ||.:::::...:.||..:  .||..|..|.|..|..|..||  .:.|    .|..|:.|.|   .
Mouse    21 PPMSSSSRGPGAGARRRR--TRCRRCRACVRTECGDCHFCRDMKKFGGPGRMKQSCLLRQC---T 80

  Fly   223 ATVLKES-----------QATQAGPSRKREKAAPKSR--NVQVGP---RAASPEIFLNPELQGIR 271
            |.||..:           :.|..|...|...:..:..  |..|.|   :....|..:|.|:....
Mouse    81 APVLPHTAVCLLCGEAGKEDTVEGEDEKFSLSLMECTICNEIVHPGCLKMGKAEGVINSEIPNCW 145

  Fly   272 QCYGPNCCSHAR 283
            :|  |.|....|
Mouse   146 EC--PRCTQEGR 155

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cfp1	NP_572556.1	PHD_Cfp1	62..107	CDD:277028
		zf-CXXC	178..218	CDD:251032	14/45 (31%)
		zf-CpG_bind_C	300..532	CDD:289071
Fbxl19	XP_036008913.1	zf-CXXC	<52..79	CDD:366873	8/26 (31%)
		PHD_FXL19	89..150	CDD:277115	11/62 (18%)
		F-box-like	426..467	CDD:403981
		AMN1	468..667	CDD:187754
		leucine-rich repeat	488..511	CDD:275381
		leucine-rich repeat	512..535	CDD:275381
		leucine-rich repeat	573..600	CDD:275381
		leucine-rich repeat	601..627	CDD:275381
		leucine-rich repeat	631..655	CDD:275381
		leucine-rich repeat	656..680	CDD:275381
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1632
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900