DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and CBR3

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001227.1 Gene:CBR3 / 874 HGNCID:1549 Length:277 Species:Homo sapiens


Alignment Length:260 Identity:63/260 - (24%)
Similarity:99/260 - (38%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQ-----PALV 60
            |:...:|.|:|||:.|||.|.|.:.     |...:|..|...:.||...:.|.|.|     |...
Human     1 MSSCSRVALVTGANRGIGLAIAREL-----CRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFH 60

  Fly    61 VGDIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYD----RVMNTNLRAIYHL 121
            ..||......:.:.....::||.|:||||||.:    ..::.....:|    ..:.||..|..::
Human    61 QLDIDDLQSIRALRDFLRKEYGGLNVLVNNAAV----AFKSDDPMPFDIKAEMTLKTNFFATRNM 121

  Fly   122 TMLATPELVKTKGNIVNVSSVNGIRSF-----------------PGVLA---------------- 153
            .....| ::|..|.:||:||:..:|:|                 .|.|.                
Human   122 CNELLP-IMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHE 185

  Fly   154 --------YNISKMGVDQFTRCVALEL----AAKGVRVNCVNPGVTVTNLHARGGM-----DAET 201
                    |.:||:||...:|.:|..|    .|..:.||...||...|::..:..:     .|||
Human   186 REGWPNSPYGVSKLGVTVLSRILARRLDEKRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAET 250

  Fly   202  201
            Human   251  250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 63/260 (24%)
NADB_Rossmann 3..253 CDD:304358 62/258 (24%)
CBR3NP_001227.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 62/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.