DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and CBR1

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001748.1 Gene:CBR1 / 873 HGNCID:1548 Length:277 Species:Homo sapiens


Alignment Length:235 Identity:60/235 - (25%)
Similarity:89/235 - (37%) Gaps:56/235 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQ-----PALVVGDIAK 66
            |.|:||.:.|||.|..     ...|...:|..|...:.|....:.|.|.|     |.....||..
Human     7 VALVTGGNKGIGLAIV-----RDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDD 66

  Fly    67 EADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
            ....:.:.....::||.||||||||||.......|....|.:..|.||......:.....| |:|
Human    67 LQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLP-LIK 130

  Fly   132 TKGNIVNVSSVNGIRSFP---------------------GVL--------------------AYN 155
            .:|.:|||||:..:|:..                     |::                    ||.
Human   131 PQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYG 195

  Fly   156 ISKMGVDQFTRCVALELA--AKG--VRVNCVNPGVTVTNL 191
            ::|:||...:|..|.:|:  .||  :.:|...||...|::
Human   196 VTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDM 235

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 60/235 (26%)
NADB_Rossmann 3..253 CDD:304358 60/235 (26%)
CBR1NP_001748.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 60/235 (26%)
Glutathione binding 95..97 0/1 (0%)