DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and YMR226C

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:80/263 - (30%)
Similarity:119/263 - (45%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKVVLITGASSGIGAATAIKF--AKYGAC-LALNGRNVENLKKVAAECSKVSQSQPALVVG--- 62
            |.|.|||||||:|||.|||:::  |..|.. |.|..|.:|.|:::.   ..:.|..|...|.   
Yeast    12 AKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELK---KTIDQEFPNAKVHVAQ 73

  Fly    63 -DIAKEADTQRIWSETL-QQYGKLDVLVNNAGII----ETGTIETTSLEQYDRVMNTNLRAIYHL 121
             ||. :|:..:.:.|.| |::..:|:||||||..    ..|.|.|..::.   |.:||:.|:.::
Yeast    74 LDIT-QAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQD---VFDTNVTALINI 134

  Fly   122 TMLATPEL-VKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPG 185
            |....|.. .|..|:|||:.|:.|..::|....|..||..|..||..:..||....:||..:.||
Yeast   135 TQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRVILIAPG 199

  Fly   186 VTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLAS--------DEASFSTGV 242
            :..|.      .....|:...|.:|..:....|....:||..|.:..|        |...|.|..
Yeast   200 LVETE------FSLVRYRGNEEQAKNVYKDTTPLMADDVADLIVYATSRKQNTVIADTLIFPTNQ 258

  Fly   243 SLP 245
            :.|
Yeast   259 ASP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 80/263 (30%)
NADB_Rossmann 3..253 CDD:304358 80/263 (30%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 79/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.