DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and IRC24

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:251 Identity:76/251 - (30%)
Similarity:121/251 - (48%) Gaps:39/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIG---AATAI----KFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG 62
            |||:||||||.|||   ..|.|    :...||  :|.....:::|::      :....:....|.
Yeast     2 GKVILITGASRGIGLQLVKTVIEEDDECIVYG--VARTEAGLQSLQR------EYGADKFVYRVL 58

  Fly    63 DIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTS-------LEQYDRVMNTNLRAIYH 120
            ||...:..:.:..|..|::||||.:|.|||::|  .:::.|       ::|::|:.:.|..:|..
Yeast    59 DITDRSRMEALVEEIRQKHGKLDGIVANAGMLE--PVKSISQSNSEHDIKQWERLFDVNFFSIVS 121

  Fly   121 LTMLATPELVKTK---GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCV 182
            |..|..| |:|:.   ||||.|||...::.:.|..||..||..::.|...:|.|..:..||..|:
Yeast   122 LVALCLP-LLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCI 185

  Fly   183 NPGVTVTNLH-------ARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFL 231
            .|||..|.:.       ...||..:..::|.:..||:..|    |.|..||.:|.|
Yeast   186 APGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLL----DPKVPAAVLAQL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 76/251 (30%)
NADB_Rossmann 3..253 CDD:304358 76/251 (30%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341294
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.