DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT1G24360

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_564216.1 Gene:AT1G24360 / 839053 AraportID:AT1G24360 Length:319 Species:Arabidopsis thaliana


Alignment Length:246 Identity:89/246 - (36%)
Similarity:130/246 - (52%) Gaps:10/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLITGASSGIGAATAIKFAKYGACLALN-GRNVENLKKVAAECSKVSQSQPALVVGDIAKEADT 70
            ||:|||||.|||.|.|:...|.|..:.:| .|:.:..::||.:..:.. .|.....||::|..|.
plant    78 VVVITGASRGIGKAIALALGKAGCKVLVNYARSAKEAEEVAKQIEEYG-GQAITFGGDVSKATDV 141

  Fly    71 QRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTK-G 134
            ..:....|.::|.:||:||||||.....:......|:|.|:..||..::..|..|...::|.| |
plant   142 DAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVKIMMKKKRG 206

  Fly   135 NIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGGMDA 199
            .|:|:|||.|:....|...|..:|.||..|::..|.|.|::.:.||.|.||...:::.|..|.|.
plant   207 RIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAELGEDM 271

  Fly   200 ETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLA-SDEASFSTGVSLPVDGG 249
            |  ||.|    .|..|||.|..:|||..:.||| |..||:.||.:..:|||
plant   272 E--KKIL----GTIPLGRYGKAEEVAGLVEFLALSPAASYITGQAFTIDGG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 89/246 (36%)
NADB_Rossmann 3..253 CDD:304358 89/246 (36%)
AT1G24360NP_564216.1 3oxo_ACP_reduc 79..318 CDD:273824 88/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.