DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT1G07450

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_172225.1 Gene:AT1G07450 / 837257 AraportID:AT1G07450 Length:260 Species:Arabidopsis thaliana


Alignment Length:263 Identity:86/263 - (32%)
Similarity:131/263 - (49%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGA----C----LALNGRNVENLKKVAAECSKVSQSQPALVV 61
            |...|:||.|.|||.|...:...:||    |    ..||    |.|....|:..:||.|     :
plant    10 GMTALVTGGSKGIGYAIVEELVGFGARVHICDIDETLLN----ECLSGWHAKGFEVSGS-----I 65

  Fly    62 GDIAKEADTQRIWSETLQQYG-KLDVLVNNAG-IIETGTIETTSLEQYDRVMNTNLRAIYHLTML 124
            .|::......::.......:| ||::|:||.| .|...|:|:|: |.:..:|.|||.:.|:::.|
plant    66 CDVSSRPQRVQLMQTVSSLFGAKLNILINNVGKYILKPTLESTA-EDFSSLMATNLESAYYISQL 129

  Fly   125 ATPELVKT--KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVT 187
            |.| |:|.  .||||.:|||.|:.|....: |.::|..::|..|.:|.|.|:..:|.|.|.|.||
plant   130 AHP-LLKASGNGNIVFISSVTGVVSGTSTI-YGVTKGALNQLARDLACEWASDNIRANSVAPWVT 192

  Fly   188 VTNLHARGGMDAETYKKFLEHSKTTHA------LGRPGDVKEVAAAIAFLASDEASFSTGVSLPV 246
            .|:|          .:|:||......|      |||..:.:|||:.:.||....||:.||.::.:
plant   193 ATSL----------VQKYLEDEIFAEAMFSRTPLGRACEPREVASLVTFLCLPAASYITGQTICI 247

  Fly   247 DGG 249
            |||
plant   248 DGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 86/263 (33%)
NADB_Rossmann 3..253 CDD:304358 86/263 (33%)
AT1G07450NP_172225.1 PRK09242 5..256 CDD:181721 86/263 (33%)
NADB_Rossmann 5..254 CDD:304358 86/263 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.