DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT5G18210

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_197322.2 Gene:AT5G18210 / 831939 AraportID:AT5G18210 Length:277 Species:Arabidopsis thaliana


Alignment Length:247 Identity:80/247 - (32%)
Similarity:125/247 - (50%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFAGKVVLITGASSGIGAATAIKFAKYGACLALN--GRNVENLKKVAAECSKVSQS--QPALVV- 61
            :.||:|.::||:|.|||.|.||..|:.||.:.:|  .|:.| ..:||||.:..:.:  ||..|| 
plant     7 SLAGRVAIVTGSSRGIGRAIAIHLAELGAKIVINYTTRSTE-ADQVAAEINSSAGTVPQPIAVVF 70

  Fly    62 -GDIAKEADTQRIWSETLQQYGK-LDVLVNNAGIIETG--TIETTSLEQYDRVMNTNLRAIYHLT 122
             .||::.:..:.::....:.:.. :.:|||:|||:...  ||..|.:|::||:...|.|.    :
plant    71 LADISEPSQIKSLFDAAEKAFNSPVHILVNSAGILNPNYPTIANTPIEEFDRIFKVNTRG----S 131

  Fly   123 MLATPELVKT-----KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCV 182
            .|...|..|.     .|.|:.::|.......||..||..||..|:...:.:|.||...|:..|||
plant   132 FLCCKEAAKRLKRGGGGRIILLTSSLTEALIPGQGAYTASKAAVEAMVKILAKELKGLGITANCV 196

  Fly   183 NPGVTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASD 234
            :||...|.:.. .|...||....:|.|    ..||.|:.|::|:.:.|||||
plant   197 SPGPVATEMFF-DGKSEETVMNIIERS----PFGRLGETKDIASVVGFLASD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 80/247 (32%)
NADB_Rossmann 3..253 CDD:304358 80/246 (33%)
AT5G18210NP_197322.2 fabG 7..245 CDD:235500 80/247 (32%)
NADB_Rossmann 8..245 CDD:304358 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.