DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT5G06060

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_196225.1 Gene:AT5G06060 / 830493 AraportID:AT5G06060 Length:264 Species:Arabidopsis thaliana


Alignment Length:270 Identity:91/270 - (33%)
Similarity:142/270 - (52%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG---D 63
            :.|||..|:||.:.|||.|...:.||:||.:....||.|.|.    .|....::...:|.|   |
plant     8 SLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELN----ACLNDWKANGLVVSGSVCD 68

  Fly    64 IAKEADTQRIWSETLQQY-GKLDVLVNNAGI-IETGTIETTSLEQYDRVMNTNLRAIYHLTMLAT 126
            .:.....:::..|....: |||::|:||.|. :...|:|.:| |:|.::|:|||.:.:||:.:|.
plant    69 ASVRDQREKLIQEASSAFSGKLNILINNVGTNVRKPTVEYSS-EEYAKIMSTNLESAFHLSQIAH 132

  Fly   127 PELVKTK--GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVT 189
            | |:|..  |:||.:|||.|:........|..:|..::|.||.:|.|.|:..:|.|||.|....|
plant   133 P-LLKASGVGSIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIRTNCVAPWYIKT 196

  Fly   190 NLHARGGMDAETY---KKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG-- 249
            :|       .||.   |:|:|...:...|||.|:.:||::.:|||....:|:.||..:.||||  
plant   197 SL-------VETLLEKKEFVEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYITGQVISVDGGFT 254

  Fly   250 ----RHAMCP 255
                .:||.|
plant   255 VNGFSYAMKP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 88/263 (33%)
NADB_Rossmann 3..253 CDD:304358 88/265 (33%)
AT5G06060NP_196225.1 TR_SDR_c 6..256 CDD:187590 88/260 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.