DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT4G03140

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_567251.2 Gene:AT4G03140 / 828065 AraportID:AT4G03140 Length:343 Species:Arabidopsis thaliana


Alignment Length:266 Identity:86/266 - (32%)
Similarity:128/266 - (48%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALN------GRNVENLKKVAAECSKVSQSQPALVVGD 63
            |||.||||.:||||.|||.||..:||.:.:.      ||..|  :::...|        |....|
plant    80 GKVALITGGASGIGKATAGKFISHGAKVIIADIQPQIGRETE--QELGPSC--------AYFPCD 134

  Fly    64 IAKEADTQRIWSETLQQYGKLDVLVNNAGI-IET-GTIETTSLEQYDRVMNTNLR----AIYHLT 122
            :.||:|........:..:.|||::.||||| .:| .:|....|..:|:|:|||:|    .|.|..
plant   135 VTKESDIANAVDFAVSLHTKLDIMYNNAGIPCKTPPSIVDLDLNVFDKVINTNVRGVMAGIKHAA 199

  Fly   123 MLATPELVKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVT 187
            .:..|   :..|:|:...||.|:........|::||..|....|..|.||....:||||::|...
plant   200 RVMIP---RNSGSIICAGSVTGMMGGLAQHTYSVSKSAVIGIVRSTASELCKHRIRVNCISPFAI 261

  Fly   188 VTNL------HARGGMDAETYKKFLEHSKTTHALGRPGDVKE---VAAAIAFLASDEASFSTGVS 243
            .|:.      ....|:|.   .:.::..::|..|.  |:|.|   ||.|..:||||::.:..|.:
plant   262 TTSFVMDEMRQIYPGVDD---SRLIQIVQSTGVLN--GEVCEPTDVANAAVYLASDDSKYVNGHN 321

  Fly   244 LPVDGG 249
            |.||||
plant   322 LVVDGG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 86/266 (32%)
NADB_Rossmann 3..253 CDD:304358 86/266 (32%)
AT4G03140NP_567251.2 PLN02253 77..331 CDD:177895 86/266 (32%)
NADB_Rossmann 77..329 CDD:304358 86/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.