DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT3G55310

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_191091.2 Gene:AT3G55310 / 824697 AraportID:AT3G55310 Length:279 Species:Arabidopsis thaliana


Alignment Length:259 Identity:87/259 - (33%)
Similarity:137/259 - (52%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQS--QPALVVGDIAKEA 68
            ||||:||||||||....:..||.|..:....|.|:.|..:.:|.:..|.:  |.|.:..|::.:|
plant    20 KVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVSSDA 84

  Fly    69 DT-QRIWSETLQQYGKLDVLVNNAGIIETGTIETT---SLEQYDRVMNTNLR-----AIYHLTML 124
            .| |:...|....:||:|.|:|||||  .|.::.:   |.:::|.|.||||:     |.|...::
plant    85 ATIQKAVREAWDIFGKIDALINNAGI--RGNVKLSLDLSEDEWDNVFNTNLKGPWLVAKYVCVLM 147

  Fly   125 ATPELVKTKGNIVNVSSVNGIRSF-PGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTV 188
            ..   .|..|:::|:|||.|:||. ||.|||:.||.|||..:|.:|:||....:|||.:.||:..
plant   148 RD---AKRGGSVINISSVAGVRSIVPGGLAYSCSKGGVDTMSRMMAIELGVHKIRVNSIAPGLFK 209

  Fly   189 TNLHARGGMDAETYKKFLEHS---KTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            :.: .:..|..|..|...|.:   |....:. ||    :.:.:.:|..|.:.:.:|.:..||.|
plant   210 SEI-TQALMQKEWLKNVTERTVPLKVQQTID-PG----LTSLVRYLIHDSSQYISGNTYIVDSG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 87/259 (34%)
NADB_Rossmann 3..253 CDD:304358 87/259 (34%)
AT3G55310NP_191091.2 SDR_c 22..265 CDD:212491 82/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.