DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT3G55290

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_567019.1 Gene:AT3G55290 / 824695 AraportID:AT3G55290 Length:280 Species:Arabidopsis thaliana


Alignment Length:258 Identity:88/258 - (34%)
Similarity:137/258 - (53%) Gaps:24/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQS--QPALVVGDIAKEA 68
            ||||:||||||||....:..||.|..:....|.|:.|..:.:|.:..|.:  |.|.:..|::.:|
plant    21 KVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVSSDA 85

  Fly    69 DT-QRIWSETLQQYGKLDVLVNNAGIIETGTIETT---SLEQYDRVMNTNLRAIY----HLTMLA 125
            .| |:...|....:||:|.|:|||||  .|.::::   |.:::|.|..|||:..:    |:.||.
plant    86 ATIQKAVREAWDIFGKIDALINNAGI--RGNVKSSLDLSEDEWDNVFKTNLKGPWLVSKHVCMLM 148

  Fly   126 TPELVKTKGNIVNVSSVNGIRS-FPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVT 189
            ..  .|..|:::|:||:.|||. .||.|||..||.|||..:|.:||||....:|||.:.||:..:
plant   149 RD--AKRGGSVINISSIAGIRGMLPGGLAYACSKGGVDTMSRMMALELGVHKIRVNSIAPGLFKS 211

  Fly   190 NLHARGGMDAETYKKFLEHS---KTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            .: .:|.|..|..|...|.:   |....:. ||    :.:.:.:|..|.:.:.:|.:..||.|
plant   212 EI-TQGLMQKEWLKNVTERTVPLKVQQTVD-PG----LTSLVRYLIHDSSQYISGNTYIVDSG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 88/258 (34%)
NADB_Rossmann 3..253 CDD:304358 88/258 (34%)
AT3G55290NP_567019.1 fabG 18..271 CDD:235546 88/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.