DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and HSD2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001154667.1 Gene:HSD2 / 823889 AraportID:AT3G47350 Length:321 Species:Arabidopsis thaliana


Alignment Length:191 Identity:66/191 - (34%)
Similarity:104/191 - (54%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAK 66
            |..||||||||||||||...|.::||.||.|||..|..:.|:.||....::......::.||::.
plant    43 NVTGKVVLITGASSGIGEHVAYEYAKKGAKLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVSN 107

  Fly    67 EADTQRIWSETLQQYGKLDVLVNNAGIIETGTIET-TSLEQYDRVMNTNLRAIYHLTMLATPELV 130
            ..|.::...||:..:||||.|:||||:.:|...|. |.::..:.:|:.|.....::|..|.|.|.
plant   108 VEDCKKFIDETIHHFGKLDHLINNAGVPQTVIFEDFTQIQDANSIMDINFWGSTYITYFAIPHLR 172

  Fly   131 KTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNL 191
            |:||.||.:||...|........|:.||..:.:|...:.:|: :..:::....||...|::
plant   173 KSKGKIVVISSATAIIPLQAASVYSASKAALVKFFETLRVEI-SPDIKITIALPGFISTDM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 66/191 (35%)
NADB_Rossmann 3..253 CDD:304358 65/190 (34%)
HSD2NP_001154667.1 NADB_Rossmann 44..262 CDD:304358 65/190 (34%)
adh_short 47..240 CDD:278532 64/187 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.