DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT3G46170

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_190203.1 Gene:AT3G46170 / 823760 AraportID:AT3G46170 Length:288 Species:Arabidopsis thaliana


Alignment Length:268 Identity:86/268 - (32%)
Similarity:135/268 - (50%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQS-----QPALVVGDIA 65
            ||||:||||||||....:...|.|..:....|.|:.|..:   ||:::.|     |.|.:..|:.
plant    29 KVVLVTGASSGIGREICLDLGKAGCKIIAVARRVDRLNSL---CSEINSSSSTGIQAAALKLDVT 90

  Fly    66 KEADT-QRIWSETLQQYGKLDVLVNNAGIIETGTIETT---SLEQYDRVMNTNLRAIYHLTMLAT 126
            .:|.| |::.......:||:|.|:|||||  .|.::::   |.|::|.|..|||..         
plant    91 SDAATIQKVVQGAWGIFGKIDALINNAGI--RGNVKSSLDLSKEEWDNVFKTNLTG--------- 144

  Fly   127 PELV-----------KTKGNIVNVSSVNGIRS-FPGVLAYNISKMGVDQFTRCVALELAAKGVRV 179
            |.||           |..|:::|:||:.|||. .||.|||..||:|||..::.:|:||....:||
plant   145 PWLVSKYVCVLMRDAKLGGSVINISSIAGIRGILPGALAYACSKIGVDTMSKMMAVELGVHKIRV 209

  Fly   180 NCVNPGVTVTNLHARGGMDAETYKKFLEHS---KTTHALGRPGDVKEVAAAIAFLASDEASFSTG 241
            |.:.||:..:.: .:|.|..|.:|...|.:   |....:. ||    :.:.:.:|..|.:.:.:|
plant   210 NSIAPGIFKSEI-TQGLMQKEWFKNVTERTVPLKLQQTVD-PG----ITSLVRYLIHDSSQYISG 268

  Fly   242 VSLPVDGG 249
            .:..||.|
plant   269 NTYIVDSG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 86/268 (32%)
NADB_Rossmann 3..253 CDD:304358 86/268 (32%)
AT3G46170NP_190203.1 SDR_c 31..274 CDD:212491 81/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.