DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and SDR4

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_189570.3 Gene:SDR4 / 822580 AraportID:AT3G29250 Length:298 Species:Arabidopsis thaliana


Alignment Length:261 Identity:79/261 - (30%)
Similarity:120/261 - (45%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG------- 62
            ||:.:|||.:|||||.....|..:||            |.|..:..:......|:.:|       
plant    46 GKIAIITGGASGIGAEAVRLFTDHGA------------KVVIVDIQEELGQNLAVSIGLDKASFY 98

  Fly    63 --DIAKEADTQRIWSETLQQYGKLDVLVNNAGIIET-GTIETTSLEQYDRVMNTNLRAIYHLTML 124
              ::..|.|.:.....|::::||||||.:|||::|. |::....||.:||.|..|:|........
plant    99 RCNVTDETDVENAVKFTVEKHGKLDVLFSNAGVLEAFGSVLDLDLEAFDRTMAVNVRGAAAFIKH 163

  Fly   125 ATPELVK--TKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVT 187
            |...:|.  |:|:||..:|:......||..:|..||..:....|.....|...|:|||.|.|...
plant   164 AARSMVASGTRGSIVCTTSIAAEIGGPGPHSYTASKHALLGLIRSACAGLGQYGIRVNGVAPYGV 228

  Fly   188 VTNLHARGGMDAETYKKFLEHSKTTHALGRPGDV----KEVAAAIAFLASDEASFSTGVSLPVDG 248
            .|.:  ....:.|..|...|:.:   |||....|    :.:|.|..|||||::.:.:|.:|.|||
plant   229 ATGM--TSAYNEEAVKMLEEYGE---ALGNLKGVVLKARHIAEAALFLASDDSVYISGQNLVVDG 288

  Fly   249 G 249
            |
plant   289 G 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 79/261 (30%)
NADB_Rossmann 3..253 CDD:304358 79/261 (30%)
SDR4NP_189570.3 PLN02253 42..293 CDD:177895 79/261 (30%)
NADB_Rossmann 44..291 CDD:304358 79/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.