DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT3G26770

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_566798.1 Gene:AT3G26770 / 822290 AraportID:AT3G26770 Length:306 Species:Arabidopsis thaliana


Alignment Length:264 Identity:87/264 - (32%)
Similarity:126/264 - (47%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            |||.||||.:||:|.|||.:|.::||.:.:...:.|...|.|.|..    |:...|..|:..|||
plant    43 GKVALITGGASGLGKATASEFLRHGARVVIADLDAETGTKTAKELG----SEAEFVRCDVTVEAD 103

  Fly    70 TQRIWSETLQQYGKLDVLVNNAGII---ETGTIETTSLEQYDRVMNTN----LRAIYHLTMLATP 127
            .......|:::||||||:.|||||:   ...:|....:.:::|||..|    :..|.|......|
plant   104 IAGAVEMTVERYGKLDVMYNNAGIVGPMTPASISQLDMTEFERVMRINVFGVVSGIKHAAKFMIP 168

  Fly   128 ELVKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLH 192
               ...|.|:..|||.|:.......:|.|||.......:..|.||...|||:||::||...|.|.
plant   169 ---ARSGCILCTSSVAGVTGGLAPHSYTISKFTTPGIVKSAASELCEHGVRINCISPGTVATPLT 230

  Fly   193 ARGGMDAETYKKF--LEHSKTTHALGRPGDVK-------EVAAAIAFLASDEASFSTGVSLPVDG 248
            .     :...|.|  :...|....:...|::|       :||.|..:|||::..:.||.:|.|||
plant   231 L-----SYLQKVFPKVSEEKLRETVKGMGELKGAECEEADVAKAALYLASNDGKYVTGHNLVVDG 290

  Fly   249 GRHA 252
            |..|
plant   291 GMTA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 85/260 (33%)
NADB_Rossmann 3..253 CDD:304358 87/264 (33%)
AT3G26770NP_566798.1 PLN02253 38..294 CDD:177895 86/262 (33%)
NADB_Rossmann 40..293 CDD:304358 86/261 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.