DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT3G04000

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_566221.2 Gene:AT3G04000 / 819555 AraportID:AT3G04000 Length:272 Species:Arabidopsis thaliana


Alignment Length:262 Identity:77/262 - (29%)
Similarity:131/262 - (50%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKVVLITGASSGIGAATAIKFAKYGACLALN-GRNVENLKKVA----AECSK---VSQSQPALV 60
            ||:|.::||:|.|||.|.||..|:.||.:.:| ..:....:|||    ..|||   |:...|.::
plant    15 AGRVAIVTGSSRGIGRAIAIHLAELGARVVVNYSTSPVEAEKVATAITTNCSKDAEVAGKSPRVI 79

  Fly    61 V--GDIAKEADTQRIWSETLQQY-GKLDVLVNNAGIIET--GTIETTSLEQYDRVMNTNLRAIYH 120
            |  .||::.:..:.::.|..:.: ..:.:|||:|.|.:.  .||...|:|.:||:::.|.|..:.
plant    80 VVKADISEPSQVKSLFDEAERVFESPVHILVNSAAIADPNHSTISDMSVELFDRIISVNTRGAFI 144

  Fly   121 LTMLATPELVKTKGN---IVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCV 182
            ....|...|.:..|.   :::.|.|..:.:..|  :|..||..|:...:.:|.||....:.||||
plant   145 CAREAANRLKRGGGGRIILLSTSLVQTLNTNYG--SYTASKAAVEAMAKILAKELKGTEITVNCV 207

  Fly   183 NPGVTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVD 247
            :||...|.:...|     ...:.:|..|:.:..||.|:.|::|..:.|||||...:..|..:..:
plant   208 SPGPVATEMFYTG-----LSNEIVEKVKSQNLFGRIGETKDIAPVVGFLASDAGEWINGQVIMAN 267

  Fly   248 GG 249
            ||
plant   268 GG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 77/262 (29%)
NADB_Rossmann 3..253 CDD:304358 77/262 (29%)
AT3G04000NP_566221.2 SDR 14..269 CDD:330230 75/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.